SecReT6
Protein ID: 447919077
SecReT6 ID729
T6SS typei3
Gene symbol-
Locus tagH045_20435
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]4637626..4638636 [+]
Producttype VI secretion protein TssG1
NoteTssG
UniProt IDM4K586
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.50E-112, Aligned region: 9..309
Protein Sequence: 336 a.a.     [Download]
>gi|447919077|ref|YP_007399645.1| type VI secretion protein TssG1 [Pseudomonas poae RE*1-1-14]
MSTLDAMHQEPWEYDFFQALRRIECESPDLPRLGHSLRLADDPLRLGQQADCTFAPATLASVDPGGDGKP
ARLEQFFFGLGGPNGPLPLHITEYVRERQRNNADSTSKQFLDVFHHRLLSLFYRAWAEARPTVSHDRPDD
DYWSARLAALSGRGMPSLLNQGLIPDTAKLHYSGHLSAQTRYPDGLKAILGEYFGLPVEIEEYVGQWLEL
PERSRVGVSANQLGVDFCLGSHVWDRQHKFRIRLGPLTLEDYMGMLPGGQPFNELVAWVAEYLGHELDWD
LNLILQQPEVPTLQLNGQFRLGFNTWLGQPERDANDLILARHYADHATTSRNPEHG
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|447915004|ref|NC_020209.1|:4637626-4638636 Pseudomonas poae RE*1-1-14, complete genome
GTGAGTACCTTGGACGCGATGCACCAGGAGCCCTGGGAATATGACTTTTTCCAGGCGCTGCGGCGTATCG
AATGCGAATCGCCGGACCTGCCGCGACTGGGCCACTCCCTGCGCCTGGCGGACGACCCGCTGCGCCTGGG
GCAACAGGCCGACTGCACGTTCGCTCCGGCTACGCTGGCGTCGGTCGACCCCGGTGGCGACGGCAAACCG
GCGCGGCTCGAACAGTTTTTCTTCGGCCTCGGCGGCCCCAACGGCCCGCTGCCGCTGCATATCACCGAGT
ACGTGCGCGAACGCCAGCGCAACAACGCCGACAGCACCAGCAAGCAGTTTTTGGATGTGTTCCATCACCG
TCTGCTGAGTCTGTTTTACCGGGCATGGGCCGAGGCGCGGCCGACGGTCAGCCACGACCGCCCGGACGAT
GACTACTGGTCCGCGCGCCTGGCGGCGTTAAGCGGCCGGGGCATGCCGAGTCTGTTGAACCAGGGGCTGA
TCCCCGACACGGCGAAGCTGCATTACAGCGGTCATCTGTCGGCGCAAACCCGCTACCCGGACGGTTTGAA
GGCGATTCTCGGCGAGTACTTCGGCCTGCCGGTGGAGATCGAGGAATACGTCGGCCAATGGCTGGAACTG
CCCGAGCGCAGCCGCGTGGGCGTGAGCGCCAACCAGCTGGGCGTGGACTTCTGCCTGGGCAGCCATGTGT
GGGACCGCCAGCATAAATTCCGCATCCGCCTGGGCCCGCTCACGCTGGAGGATTACATGGGCATGCTGCC
AGGCGGTCAGCCGTTCAACGAGCTGGTGGCGTGGGTGGCCGAGTACCTGGGCCATGAACTGGACTGGGAC
CTGAACCTGATTCTGCAACAACCCGAAGTCCCAACACTGCAGCTTAACGGCCAGTTCCGCCTGGGCTTCA
ACACCTGGCTCGGCCAACCCGAGCGGGACGCCAACGACCTAATCCTGGCCCGGCATTACGCCGATCACGC
CACCACCTCAAGGAATCCAGAGCATGGGTGA
 Primer design