SecReT6
Protein ID: 447919078
SecReT6 ID729
T6SS typei3
Gene symbol-
Locus tagH045_20440
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]4638629..4641283 [+]
Producttype VI secretion ATPase ClpV1
NoteTssH
UniProt IDM4KBQ2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.90E-39, Aligned region: 615..781
AAA [PF00004], Evalue: 8.70E-19, Aligned region: 130..152
AAA [PF00004], Evalue: 8.70E-19, Aligned region: 233..367
AAA [PF00004], Evalue: 8.70E-19, Aligned region: 621..705
ClpB_D2-small [PF10431], Evalue: 7.70E-15, Aligned region: 788..862
AAA_5 [PF07728], Evalue: 2.30E-12, Aligned region: 233..252
AAA_5 [PF07728], Evalue: 2.30E-12, Aligned region: 356..363
AAA_5 [PF07728], Evalue: 2.30E-12, Aligned region: 620..734
AAA_16 [PF13191], Evalue: 2.80E-12, Aligned region: 43..78
AAA_16 [PF13191], Evalue: 2.80E-12, Aligned region: 210..250
AAA_16 [PF13191], Evalue: 2.80E-12, Aligned region: 277..312
AAA_16 [PF13191], Evalue: 2.80E-12, Aligned region: 449..535
AAA_16 [PF13191], Evalue: 2.80E-12, Aligned region: 590..665
AAA_16 [PF13191], Evalue: 2.80E-12, Aligned region: 780..827
Sigma54_activat [PF00158], Evalue: 8.40E-07, Aligned region: 212..246
Sigma54_activat [PF00158], Evalue: 8.40E-07, Aligned region: 619..738
AAA_22 [PF13401], Evalue: 1.60E-06, Aligned region: 63..98
AAA_22 [PF13401], Evalue: 1.60E-06, Aligned region: 232..313
AAA_22 [PF13401], Evalue: 1.60E-06, Aligned region: 355..396
AAA_22 [PF13401], Evalue: 1.60E-06, Aligned region: 618..641
AAA_22 [PF13401], Evalue: 1.60E-06, Aligned region: 682..702
AAA_25 [PF13481], Evalue: 7.70E-06, Aligned region: 228..310
AAA_25 [PF13481], Evalue: 7.70E-06, Aligned region: 618..645
Zeta_toxin [PF06414], Evalue: 3.70E-05, Aligned region: 233..249
Zeta_toxin [PF06414], Evalue: 3.70E-05, Aligned region: 614..660
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 211..249
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 284..318
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 620..641
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 687..702
AAA_19 [PF13245], Evalue: 0.00031, Aligned region: 17..46
AAA_19 [PF13245], Evalue: 0.00031, Aligned region: 233..254
AAA_19 [PF13245], Evalue: 0.00031, Aligned region: 618..642
Clp_N [PF02861], Evalue: 0.00032, Aligned region: 29..75
Clp_N [PF02861], Evalue: 0.00032, Aligned region: 108..143
IstB_IS21 [PF01695], Evalue: 0.0004, Aligned region: 216..254
IstB_IS21 [PF01695], Evalue: 0.0004, Aligned region: 620..648
NACHT [PF05729], Evalue: 0.00052, Aligned region: 233..333
NACHT [PF05729], Evalue: 0.00052, Aligned region: 488..529
NACHT [PF05729], Evalue: 0.00052, Aligned region: 621..647
AAA_18 [PF13238], Evalue: 0.00055, Aligned region: 233..250
AAA_18 [PF13238], Evalue: 0.00055, Aligned region: 622..648
AAA_18 [PF13238], Evalue: 0.00055, Aligned region: 810..851
AAA_17 [PF13207], Evalue: 0.0014, Aligned region: 233..250
AAA_17 [PF13207], Evalue: 0.0014, Aligned region: 620..656
AAA_29 [PF13555], Evalue: 0.0017, Aligned region: 225..249
AAA_29 [PF13555], Evalue: 0.0017, Aligned region: 618..645
Torsin [PF06309], Evalue: 0.0022, Aligned region: 578..644
Protein Sequence: 884 a.a.     [Download]
>gi|447919078|ref|YP_007399646.1| type VI secretion ATPase ClpV1 [Pseudomonas poae RE*1-1-14]
MGEISRAALFGKLNSVAYKAIEAATVFCKLRGNPYVELAHWFHQLLQLQDSDLHRIIRQFNVEPARLARD
LTEALDRLPRGSTSITDLSSHVEEAVERGWVYGSLMFGESQVRTGYLVLGILKTPSLRHALLGLSAEFDK
IKPEALSERFDEYVGDSPENALSASDGFNAGVPGEASGAMAPSAMGKQEALKRFTVDLTEQARSGKLDPI
VGRDEEIRQLVDILMRRRQNNPILTGEAGVGKTAVVEGFALRIVAGDVPPALKDVELRSLDVGLLQAGAS
MKGEFEQRLRQVIEDVQASPKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLRTVAATTWAEYK
KHIEKDPALTRRFQVVQVAEPSEDKALLMMRGVASTMEKHHQVQVLDEALEASVKLSHRYIPARQLPDKS
VSLLDTACARVAISLHAVPAEVDDSRRRIEALETELQIIAREHAIGIDIRARQTNSEALLSAERERLTTL
ESRWAEEKTLVDELLATRATLREKAGVVDSGSDELRTQLVDLQQRLSALQGETPLILPTVDYQAVASVVA
DWTGIPVGRMARNELETVLNLDQHLKKRIIGQDHALQMIAKRIQTSRAGLDNPSKPIGVFMLAGTSGVGK
TETALALAEAMYGGEQNVITINMSEFQEAHTVSTLKGAPPGYIGYGEGGVLTEAVRRKPYSVVLLDEVEK
AHPDVHEIFFQVFDKGVMEDGEGRVIDFKNTLILLTTNAGTELISQVCKDPANIPEPEEIAKALRQPLLE
IFPPALLGRLVTIPYYPLSDTMLKAITRLQLGRIKKRVESTHKVAFDYDDAVVDLIVSRCTETESGGRMI
DTILTNSLLPDMSREFLTRMLEGKALAGVRISSRDNELHYQFND
 
Nucleotide Sequence: 2655 bp     [Download]
>gi|447915004|ref|NC_020209.1|:4638629-4641283 Pseudomonas poae RE*1-1-14, complete genome
ATGGGTGAAATCAGTCGCGCCGCACTGTTCGGCAAACTCAACAGCGTGGCCTACAAGGCCATCGAAGCCG
CCACCGTGTTCTGCAAGCTGCGGGGCAACCCGTATGTGGAACTGGCTCACTGGTTCCACCAGTTGCTGCA
ACTGCAGGACTCGGACCTGCACCGCATCATCCGCCAGTTCAACGTGGAACCGGCGCGTCTGGCCCGTGAC
CTCACCGAAGCCCTGGACCGCCTGCCGCGCGGCTCGACGTCGATCACCGACCTGTCCTCCCACGTGGAAG
AAGCCGTGGAGCGCGGCTGGGTGTACGGCAGCCTGATGTTTGGCGAAAGCCAGGTGCGCACCGGGTATCT
GGTGCTGGGCATCTTGAAGACGCCGAGCCTGCGTCACGCCCTGCTGGGCTTGTCCGCCGAGTTCGACAAG
ATCAAGCCCGAAGCCCTGAGCGAGCGCTTTGACGAATACGTTGGCGACTCGCCGGAAAACGCCTTGAGCG
CCAGCGACGGTTTCAATGCCGGCGTGCCCGGCGAAGCCAGCGGCGCCATGGCGCCCAGCGCGATGGGCAA
GCAGGAAGCCCTCAAACGCTTCACCGTGGACCTCACCGAACAGGCGCGCAGCGGCAAGCTTGACCCGATC
GTGGGACGTGACGAAGAGATCCGCCAACTGGTGGACATCCTGATGCGCCGACGCCAGAACAACCCGATCC
TCACCGGTGAAGCCGGCGTGGGCAAGACCGCCGTGGTCGAAGGGTTCGCCCTGCGTATCGTCGCCGGTGA
CGTACCGCCGGCGCTCAAGGATGTGGAGCTGCGCAGCCTCGACGTGGGCCTGCTGCAAGCCGGCGCCAGC
ATGAAAGGCGAGTTCGAACAGCGCCTGCGCCAGGTCATCGAAGACGTGCAAGCCTCACCCAAGCCGATCA
TTCTGTTCATCGACGAAGCCCACACCCTGGTGGGTGCCGGTGGCGCCGCCGGCACGGGCGATGCAGCCAA
TCTGCTCAAGCCTGCGCTGGCCCGTGGCACCCTGCGTACCGTGGCCGCCACCACCTGGGCCGAGTACAAA
AAGCACATCGAGAAAGACCCGGCTCTGACCCGCCGCTTCCAGGTGGTCCAGGTGGCCGAGCCGTCAGAAG
ACAAGGCGCTGCTGATGATGCGCGGCGTGGCATCGACCATGGAGAAGCACCATCAGGTGCAGGTGCTCGA
CGAAGCCCTGGAAGCTTCGGTGAAGTTGTCGCACCGCTACATCCCCGCTCGCCAGCTACCTGACAAATCC
GTGAGCCTGCTGGACACTGCCTGCGCCCGCGTCGCCATCAGCCTGCACGCCGTGCCCGCCGAAGTGGACG
ACAGCCGCCGCCGTATCGAAGCGCTGGAAACCGAGCTGCAGATCATCGCCCGCGAACACGCCATCGGCAT
CGACATTCGCGCGCGCCAAACCAACTCCGAGGCGCTGTTGAGCGCTGAACGCGAGCGCCTGACCACCCTG
GAAAGCCGCTGGGCCGAAGAGAAGACCCTGGTGGATGAGTTGCTCGCCACCCGCGCAACCCTGCGCGAAA
AAGCCGGCGTGGTGGACAGCGGCAGCGATGAGTTGCGCACGCAACTGGTCGACCTGCAACAACGCCTCAG
CGCCCTGCAGGGCGAAACCCCACTGATCCTGCCGACCGTGGATTACCAGGCCGTGGCCTCGGTGGTCGCC
GACTGGACCGGCATCCCGGTGGGCCGTATGGCACGCAACGAGTTGGAGACGGTGCTCAACCTCGATCAGC
ACCTGAAGAAACGCATCATCGGCCAGGACCACGCCTTGCAGATGATCGCCAAGCGCATCCAGACGTCCCG
CGCCGGCCTCGACAACCCGAGCAAGCCGATTGGCGTGTTCATGCTCGCCGGCACGTCCGGCGTGGGCAAG
ACCGAAACCGCCCTTGCCCTGGCTGAAGCCATGTACGGCGGTGAGCAGAACGTGATCACCATCAACATGA
GCGAGTTCCAGGAAGCCCACACGGTATCGACGCTCAAGGGCGCGCCACCGGGCTATATCGGCTACGGCGA
AGGCGGCGTGCTGACCGAAGCGGTGCGGCGCAAGCCCTACAGCGTGGTGCTGCTGGACGAAGTGGAAAAA
GCTCACCCGGATGTGCATGAAATCTTCTTCCAGGTGTTCGATAAAGGCGTGATGGAAGACGGCGAAGGCC
GGGTGATCGACTTCAAGAACACCCTGATCCTGCTGACCACCAACGCCGGTACCGAGCTGATTTCCCAGGT
GTGCAAGGACCCGGCGAACATCCCCGAGCCCGAGGAAATCGCCAAGGCCCTGCGCCAGCCGCTGCTGGAG
ATTTTCCCGCCGGCGCTACTGGGCCGCCTGGTGACGATTCCGTACTACCCGCTGAGTGACACGATGCTCA
AGGCGATCACCCGCCTGCAATTGGGCCGCATCAAGAAGCGTGTGGAGAGCACCCACAAAGTCGCCTTCGA
CTACGACGATGCGGTGGTCGACCTGATCGTCTCGCGCTGCACCGAAACTGAAAGCGGCGGGCGCATGATC
GACACCATCCTCACCAACAGCCTGTTGCCGGACATGAGCCGTGAATTCCTCACGCGCATGCTTGAAGGCA
AGGCGCTGGCGGGGGTGCGGATCAGCAGCCGGGATAACGAGCTGCACTACCAGTTCAACGATTGA
 Primer design