SecReT6
Protein ID: 447919079
SecReT6 ID729
T6SS typei3
Gene symbol-
Locus tagH045_20445
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]4641439..4643379 [+]
Producthypothetical protein
NoteTssI
UniProt IDM4K6J8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.00E-87, Aligned region: 30..329
Phage_base_V [PF04717], Evalue: 1.30E-25, Aligned region: 369..462
Gp5_C [PF06715], Evalue: 0.0014, Aligned region: 514..536
Protein Sequence: 646 a.a.     [Download]
>gi|447919079|ref|YP_007399647.1| hypothetical protein H045_20445 [Pseudomonas poae RE*1-1-14]
MLFNQASRLARITSPLGPDVLLLNEMGGGEELGRLFNYELQLTSLDANIDLNQLLGKPMSVGVQLADGGE
RHFNGIVARCSQNIDRGQFASYQVTLRPWLWLLSRTSDCRIFQNLSIPQIIKQVFRDLGFSDFEDALSRP
YREWEYCVQYRETSFDFVSRLMEQEGIYYFFRHEQDRHVLVLADAYGAHATVPGYASIPYYPKDEQQRER
DHMHNWHLAHEVQPGSLELNDYDFQRPSASIDVRSAMPRPHAAGDYPLYDYPGTYVQSADGEHYARTRIE
ALQTLHEQIEFAGNARGLGSGHLFSLTGFSRQDQNREYLIVGCRYYITQESLESGGGTASAQFESSLTCI
DAQQSFRPLANTHRPIVKGPQTALVVGPKGEEIWTDQYGRVKVHFYWDRHDQSNENSSCWIRVSQSWAGK
NWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYDLPENATQSGMKSRSSKGGTPANFNEIRM
EDKKGLEQLYIHAERNQDIVVEVDESHSVGHDRNKSIGHNETVTIGNNRLRIVKQEDILSVGQKKTDSIS
QSYVIEVGENLRLVCGESILELNASGQINLTGVQISFYASGDAEFNTGGVLHLNNGGGAGATPDGQGVKA
SIDANIKAAFPAPKSS
 
Nucleotide Sequence: 1941 bp     [Download]
>gi|447915004|ref|NC_020209.1|:4641439-4643379 Pseudomonas poae RE*1-1-14, complete genome
ATGCTATTCAACCAAGCCTCACGCCTGGCCAGGATCACCAGCCCCCTCGGGCCGGATGTGCTGCTGCTCA
ATGAAATGGGCGGCGGTGAAGAGCTGGGCAGGCTGTTCAACTATGAGCTGCAACTGACGTCACTGGACGC
CAACATCGATCTCAACCAATTGCTGGGCAAGCCGATGAGCGTGGGCGTGCAACTGGCGGACGGCGGCGAG
CGGCACTTCAACGGCATCGTTGCGCGCTGCAGCCAGAACATCGACCGGGGCCAGTTCGCCAGTTACCAGG
TGACGCTGCGCCCCTGGCTGTGGTTGCTGAGCCGCACCTCGGACTGCCGGATTTTCCAGAACCTGAGCAT
CCCGCAGATCATCAAGCAGGTGTTTCGCGACCTGGGCTTTTCCGACTTCGAAGACGCCCTGAGCCGGCCG
TACCGCGAGTGGGAATACTGCGTGCAGTACCGCGAGACCAGCTTTGATTTCGTCAGCCGCTTGATGGAGC
AGGAAGGGATCTACTACTTCTTCCGCCATGAGCAGGACCGCCATGTACTGGTGCTGGCCGACGCCTATGG
CGCCCACGCCACGGTGCCCGGCTACGCATCGATTCCGTACTACCCCAAAGACGAGCAGCAGCGCGAACGC
GACCATATGCACAACTGGCACTTGGCGCACGAAGTACAGCCCGGCTCGCTGGAGCTTAACGACTACGACT
TCCAGCGCCCCAGCGCCAGCATCGACGTGCGCTCGGCCATGCCGCGCCCCCACGCCGCCGGCGACTACCC
GCTGTACGACTACCCCGGCACTTACGTGCAAAGCGCCGATGGCGAACACTACGCGCGCACCCGCATCGAG
GCACTGCAAACCCTGCACGAGCAGATCGAGTTCGCCGGCAATGCCCGTGGCCTGGGTTCGGGTCATCTGT
TCAGCCTTACCGGCTTCAGCCGCCAGGACCAGAACCGCGAATACCTGATTGTCGGCTGCCGCTACTACAT
CACCCAGGAAAGCCTGGAAAGCGGCGGTGGCACGGCCTCGGCGCAATTTGAAAGCAGCCTGACCTGCATC
GACGCCCAGCAGAGCTTCCGCCCGCTGGCCAACACCCATCGACCCATCGTCAAAGGCCCTCAGACCGCAC
TGGTGGTCGGCCCCAAGGGCGAGGAAATCTGGACCGACCAATACGGCCGCGTGAAGGTGCACTTTTACTG
GGACCGTCACGACCAGTCCAACGAGAACAGCTCGTGCTGGATTCGTGTCTCACAGTCCTGGGCCGGCAAG
AACTGGGGCTCGATGCAGATTCCACGCATCGGCCAGGAAGTGATCGTGAGCTTTCTGGAAGGTGACCCGG
ACCGGCCGATCATCACCGGGCGCGTCTACAACGCCGAGCAGACGGTGCCTTACGACCTGCCAGAGAACGC
CACCCAGAGCGGCATGAAAAGCCGTTCGAGCAAGGGCGGCACGCCGGCCAACTTCAATGAAATCCGCATG
GAGGACAAGAAGGGGCTGGAGCAGTTGTATATCCACGCCGAGCGCAATCAGGACATTGTGGTGGAAGTGG
ATGAGAGCCACTCGGTGGGGCATGACCGCAACAAGAGCATCGGCCACAACGAGACGGTGACCATCGGCAA
CAACCGACTGCGCATCGTCAAACAGGAAGACATTCTTTCGGTCGGGCAAAAGAAGACCGACAGTATCAGC
CAGAGCTACGTGATTGAAGTGGGTGAAAACCTGCGCCTGGTCTGCGGCGAAAGCATCCTGGAATTGAACG
CCAGCGGGCAGATCAACCTCACCGGCGTGCAAATCAGCTTCTATGCCAGCGGCGATGCCGAGTTCAACAC
CGGCGGCGTGCTGCACCTGAACAACGGCGGCGGCGCTGGCGCCACGCCTGACGGCCAGGGCGTGAAAGCC
AGCATCGACGCCAATATCAAAGCCGCCTTCCCCGCGCCCAAAAGCTCCTGA
 Primer design