SecReT6
Protein ID: 447919081
SecReT6 ID729
T6SS typei3
Gene symbol-
Locus tagH045_20455
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]4643901..4648271 [+]
Producthypothetical protein
NotePAAR
UniProt IDM4K4W0
KEGG IDppz:H045_20455
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 417..439
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 477..513
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 552..582
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 566..601
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 587..623
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 639..665
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 651..687
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 695..714
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 717..750
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 735..772
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 780..813
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 819..853
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 868..899
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 909..927
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 912..947
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 932..957
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 963..984
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 989..1001
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 1018..1034
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 1047..1081
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 1094..1106
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 1097..1133
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 1118..1151
RHS_repeat [PF05593], Evalue: 2.70E-63, Aligned region: 1139..1178
RHS [PF03527], Evalue: 2.60E-18, Aligned region: 636..661
RHS [PF03527], Evalue: 2.60E-18, Aligned region: 670..687
RHS [PF03527], Evalue: 2.60E-18, Aligned region: 797..810
RHS [PF03527], Evalue: 2.60E-18, Aligned region: 1096..1109
RHS [PF03527], Evalue: 2.60E-18, Aligned region: 1204..1243
PAAR_motif [PF05488], Evalue: 6.10E-11, Aligned region: 78..204
RES [PF08808], Evalue: 2.10E-10, Aligned region: 540..584
RES [PF08808], Evalue: 2.10E-10, Aligned region: 1346..1453
DUF4595 [PF15283], Evalue: 0.00036, Aligned region: 537..554
DUF4595 [PF15283], Evalue: 0.00036, Aligned region: 581..606
DUF4595 [PF15283], Evalue: 0.00036, Aligned region: 603..623
DUF4595 [PF15283], Evalue: 0.00036, Aligned region: 733..745
DUF4595 [PF15283], Evalue: 0.00036, Aligned region: 794..847
DUF4595 [PF15283], Evalue: 0.00036, Aligned region: 869..910
DUF4595 [PF15283], Evalue: 0.00036, Aligned region: 1112..1141
Protein Sequence: 1456 a.a.     [Download]
>gi|447919081|ref|YP_007399649.1| hypothetical protein H045_20455 [Pseudomonas poae RE*1-1-14]
MADILGGVLEVAANVAITALATAAVVAATGITVATGGLGACVLGAVVGVIVGIAMSKTGADKGLSVLCEG
IGNALFPPAVMATIISGSTDTLINSIPAARAAGAVPSHVAPAGTENQAPAPASDDAEEPGYLDMAKGFFS
QMWRPTVATPAPGAVPKPLDLVTCTKHPPMPPQFLAEGSEKVTVNGQPAVRSGDRSTCDATVVSAGLISP
NVTIGGGSVVVREIRSGKTPGVGLAVTALMMLKGGKGKFLSNLPCMLLGGVNSFVVSQAMGALANAAMGS
SNPVHASTGAKVLGGPEELDFALPGIMPIDWQRFYNSRDERRDGLFGAGWSVSYEVSVQLRPHPEGGEQL
LYTDEQGRRINMGFIPLGGAVFSAGEGLSVRRHLSGQLLIESADALYRLFEPAPQNTSLLRLSQLGDRND
NRIYLDYDDNGRLRQLRDTFDLVKVELNYDATWPSRVSHIERLYPDQQREVLMHYAYDSCGDLAAVRQSD
GQVKRRFAYDAGRRMTEHQLPGGLRCFYQWACVDEREWRVVRHWTDSGDTYRFDYELDNGITRIIDGLQR
VSTRHWDARHQILESIDALGRTWAFQWNAESQLLGATDPSGGQYQFSYDEAGNLSETTDPLGRSESTLWL
EHWALPLVETDAAGNAWQFRYDSRGNCIGETDPLGHVTTYRHDAHGQVLEITDARGASKTLRWTPLGQLS
EHTDCSGLTTRLNYCKRGLLLNSTDALGERTNFAYDDQGRLTSKQLPDGRSEHYQRDASGQLVSYSDPAG
HTTHFKHCPSGRLRQRTDSHGRCVELSHDAYGRLLNLTNENGERYRFDWDAGDRLTLEQRLNGTLKRYAY
DPLDNVTRVETVASSGAEDSITHDLERDAAGRLIAKITADGRTEYSYDEQDQVTAISFTGHYGEQQRLAF
GYDALGQLILEQSTGGRLEHHYDELGNLIQTQLPDGRWLNRLRYGSGHLHQINLDGQVISDFERDRLHRE
VLRTQGRISTRSEYDRCGRIRVRQRRQQGQSVLLPALQTRYGYDASDQLVERVDSQPGATYRQLLHYDAT
GRILASQDNLQGQREAFAYDPAANLLDGAGRVAHNQLLSYRDKHYRYDGFGRVVEKRSARRGTQHLSYDA
EQRLAQVHNDDGSVVKMTYDPLGRRIAKTTFDRQGKQQSQTRFTWDAMQLLQEHHGPQTSLYLYVDEGYE
PLARIDGVGDQQKVRYYHNDLNGLPEQLSESDGHRVWKARYEVWGNTVEEVREPYFVEEQNLRFQGQYLD
RETGLHYNTLRFYDPDIGRFTTPYPIGLAGGLNFYQYAPNPVSWIDPLGLMKCSSPPKGRKVNRTVYRFE
EPGRIGTTWQAHKWNVESRHRYTAKGLGGVYGANSRKTALGEVTHWGVDLSSRVLVSKRVQLNNVLDLTR
ADVRKQLGVSLKSITGDKYTETHQIGSWAKANGYDGILAPSARNPTGSNLISFAGF
 
Nucleotide Sequence: 4371 bp     [Download]
>gi|447915004|ref|NC_020209.1|:4643901-4648271 Pseudomonas poae RE*1-1-14, complete genome
ATGGCCGATATCCTTGGCGGTGTGCTCGAAGTCGCCGCTAACGTGGCGATCACTGCATTGGCCACGGCCG
CCGTAGTAGCGGCCACCGGGATCACCGTCGCGACAGGTGGGCTTGGCGCGTGCGTATTGGGCGCCGTCGT
CGGCGTTATTGTCGGCATCGCCATGAGCAAGACCGGTGCTGACAAAGGGCTGAGCGTCCTGTGTGAGGGT
ATCGGCAACGCGCTGTTCCCTCCCGCAGTCATGGCAACGATCATCAGCGGGTCGACAGATACCCTGATCA
ACTCAATACCTGCGGCGCGAGCCGCCGGGGCGGTCCCCTCCCACGTTGCCCCGGCGGGCACCGAAAACCA
AGCGCCTGCCCCCGCGTCTGACGATGCAGAAGAACCAGGCTACCTGGATATGGCCAAAGGTTTTTTCTCC
CAGATGTGGCGCCCCACTGTCGCCACCCCCGCACCAGGTGCCGTTCCCAAACCTCTGGATCTGGTGACCT
GCACCAAACATCCACCGATGCCACCACAGTTTCTTGCAGAAGGATCGGAAAAGGTCACGGTCAACGGCCA
GCCGGCTGTGCGCAGCGGCGATCGCAGCACGTGTGATGCGACGGTTGTGTCAGCGGGACTTATTTCGCCA
AACGTGACCATCGGCGGTGGTTCAGTGGTGGTACGCGAGATTCGTAGCGGCAAGACGCCGGGAGTGGGCC
TGGCTGTGACCGCACTAATGATGCTCAAGGGTGGCAAGGGCAAATTTCTAAGTAATCTGCCCTGCATGCT
GCTGGGGGGCGTCAACTCATTCGTCGTCAGTCAAGCCATGGGCGCCTTGGCCAATGCGGCCATGGGCTCA
TCCAACCCCGTGCATGCCAGCACTGGGGCCAAGGTGCTGGGCGGCCCGGAAGAGCTGGACTTTGCCCTGC
CCGGCATCATGCCGATCGATTGGCAGCGTTTCTACAACAGCCGGGACGAACGCCGCGATGGTCTGTTCGG
GGCTGGCTGGAGCGTTTCCTACGAGGTCAGCGTCCAGCTTCGCCCCCACCCTGAGGGTGGTGAGCAACTG
CTATACACCGACGAGCAGGGGCGACGCATAAACATGGGGTTCATTCCCTTGGGCGGCGCGGTGTTCAGTG
CTGGCGAGGGGCTGAGCGTGCGACGCCACCTGAGTGGCCAACTGCTGATCGAAAGTGCTGATGCCTTGTA
TCGACTGTTTGAACCAGCGCCGCAGAATACTTCGCTGCTACGCCTGAGCCAGTTGGGCGATCGCAATGAC
AACCGTATTTACCTGGACTATGACGACAACGGACGGCTGCGACAGCTGCGGGACACCTTCGATCTGGTTA
AGGTCGAACTGAATTACGACGCCACCTGGCCAAGCCGTGTCAGTCATATCGAGCGACTGTACCCTGATCA
GCAGCGTGAAGTGTTGATGCATTACGCCTACGACAGCTGCGGCGACCTGGCAGCCGTGCGACAGTCCGAC
GGGCAGGTGAAACGCCGGTTTGCCTATGACGCCGGCCGGCGCATGACCGAGCATCAATTACCTGGCGGGC
TGCGCTGTTTCTACCAGTGGGCGTGTGTGGATGAACGCGAATGGCGCGTGGTTCGGCACTGGACGGATAG
CGGCGACACCTACCGATTCGACTATGAGCTGGACAACGGTATCACCCGGATCATTGACGGGTTGCAGCGC
GTCAGCACCCGCCACTGGGATGCACGGCACCAGATCCTCGAGTCCATCGATGCTCTGGGACGTACCTGGG
CGTTCCAATGGAATGCTGAAAGCCAACTGCTGGGCGCGACCGACCCAAGCGGTGGGCAATACCAATTCAG
CTACGATGAAGCCGGTAATCTGAGCGAGACCACAGATCCGCTGGGGCGCAGTGAATCAACCCTTTGGCTG
GAACATTGGGCGCTGCCGTTGGTGGAGACCGACGCCGCCGGCAACGCCTGGCAGTTCCGGTATGACTCAC
GTGGCAATTGCATCGGCGAAACCGATCCGCTGGGCCACGTGACGACTTATCGTCACGACGCTCACGGACA
AGTCCTGGAAATTACCGACGCCCGCGGTGCAAGCAAGACCTTGCGCTGGACGCCCCTGGGTCAACTCAGC
GAGCACACCGACTGTTCGGGTCTGACCACCCGCTTGAATTACTGCAAGCGTGGGCTACTGCTTAACAGTA
CCGACGCCCTGGGCGAGCGCACAAACTTCGCTTATGACGATCAGGGACGGCTGACCAGCAAACAGTTGCC
GGATGGCCGCAGTGAGCACTATCAGCGTGATGCCAGTGGGCAATTGGTCAGCTACAGCGACCCTGCGGGT
CACACCACGCACTTCAAACACTGCCCAAGCGGACGGTTGCGCCAGCGTACGGACTCTCACGGCCGCTGTG
TGGAGCTGAGTCATGATGCCTACGGTCGCCTGCTGAACCTGACCAACGAGAACGGCGAGCGCTATCGCTT
CGACTGGGACGCCGGTGATCGACTGACCCTGGAGCAGCGCCTGAACGGCACGCTCAAGCGCTATGCCTAC
GATCCGCTGGATAATGTCACTCGCGTGGAGACAGTTGCTTCATCTGGCGCCGAAGACTCCATCACTCACG
ACCTGGAGCGAGACGCTGCCGGGCGACTGATCGCAAAAATCACCGCAGATGGGCGTACCGAATATAGCTA
TGACGAACAGGATCAGGTCACAGCCATCTCCTTCACCGGACATTACGGCGAGCAACAACGCCTGGCGTTC
GGGTATGACGCACTCGGCCAGCTGATTCTTGAACAAAGTACCGGCGGTCGCCTGGAACACCACTACGACG
AACTGGGTAACCTGATACAGACGCAGCTTCCCGATGGACGCTGGCTCAACCGATTGCGCTACGGAAGTGG
CCACCTGCATCAGATAAATCTGGATGGTCAGGTGATCAGTGATTTCGAGCGCGACCGGCTGCACCGCGAA
GTGCTGCGTACCCAGGGACGTATCAGCACCCGCAGCGAATACGATCGTTGCGGGCGGATTCGTGTTCGCC
AGCGTCGGCAACAGGGGCAGTCAGTACTGCTGCCAGCGCTACAAACCCGATACGGTTATGACGCCAGCGA
TCAATTGGTGGAACGCGTCGACAGCCAGCCTGGCGCAACCTACCGCCAGCTCCTGCATTACGACGCTACC
GGACGCATTCTCGCCAGCCAGGACAATCTTCAGGGGCAAAGGGAAGCCTTCGCCTATGATCCAGCCGCCA
ATTTATTGGACGGCGCAGGGCGCGTGGCCCACAACCAGTTACTGAGCTATCGCGACAAGCACTACCGTTA
CGACGGTTTTGGCAGGGTAGTTGAAAAACGCAGCGCTCGGCGCGGCACCCAGCACTTGAGCTATGACGCT
GAGCAACGCCTGGCCCAGGTGCACAATGACGACGGTTCTGTGGTCAAGATGACTTACGACCCGCTCGGTC
GACGCATCGCCAAGACCACCTTCGACCGCCAGGGCAAGCAGCAGAGCCAGACCCGTTTCACGTGGGATGC
GATGCAACTGCTGCAGGAGCACCACGGCCCGCAGACCAGCCTCTATCTCTATGTCGATGAGGGTTATGAG
CCCCTGGCCAGGATTGATGGTGTGGGTGACCAGCAAAAGGTGCGCTACTACCACAACGACCTCAACGGCC
TGCCCGAGCAACTCTCGGAAAGCGACGGCCATAGGGTGTGGAAGGCGCGTTACGAAGTCTGGGGCAATAC
CGTCGAGGAAGTGCGCGAACCCTATTTCGTCGAAGAGCAGAACCTACGGTTCCAGGGCCAGTACCTGGAC
CGGGAGACTGGGCTGCACTACAACACTCTGCGCTTTTATGACCCAGACATCGGGCGCTTCACTACGCCCT
ATCCAATCGGTCTGGCGGGCGGGCTTAATTTCTACCAATACGCGCCCAACCCGGTGAGCTGGATCGACCC
CTTGGGACTGATGAAATGCTCAAGCCCACCCAAAGGCCGCAAGGTCAATCGCACGGTGTATCGATTCGAG
GAGCCTGGACGCATCGGTACGACTTGGCAGGCGCATAAGTGGAATGTGGAGTCCCGACACCGGTACACGG
CCAAGGGACTGGGTGGCGTATATGGCGCCAACTCGCGCAAGACCGCATTGGGCGAAGTCACCCATTGGGG
TGTGGACCTGTCCTCACGGGTACTGGTCAGCAAAAGGGTGCAGTTAAACAACGTGCTGGACCTGACGCGC
GCCGACGTGCGCAAACAATTAGGTGTATCACTCAAAAGCATTACGGGTGACAAATACACCGAAACTCACC
AGATCGGCAGTTGGGCGAAAGCCAATGGCTATGATGGGATTCTTGCCCCATCCGCGCGAAACCCGACAGG
CAGCAACTTAATATCATTTGCAGGGTTCTGA
 Primer design