SecReT6
Protein ID: 448242771
SecReT6 ID730
T6SS typei3
Gene symbolimpL
Locus tagSMWW4_v1c30110
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3247396..3251031 [+]
Producttype VI secretion system protein ImpL
NoteTssM
UniProt IDL7ZMD0
KEGG IDsmw:SMWW4_v1c30110
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.10E-102, Aligned region: 207..487
IcmF-related [PF06761], Evalue: 2.80E-89, Aligned region: 535..842
DUF1215 [PF06744], Evalue: 3.50E-31, Aligned region: 953..1078
Protein Sequence: 1211 a.a.     [Download]
>gi|448242771|ref|YP_007406824.1| type VI secretion system protein ImpL [Serratia marcescens WW4]
MLSTLFSIITSRLLWGFVGITALAFIIWMIGPLVAIGDYRPLEPELNRQIAIGVIYLIWFLCRLIPRLYS
AWFNSRLLSNLRAAETVPAEDGKPEVKQDDQLAQRFDEAAQLLKKARFAPGQGDGKHRWMTRFSRQYLYQ
LPWYVIIGAPGAGKTTALVNSGLHFPLADRFGKSALRGVGGTRNCDWWFTNDAVLLDTAGRYTTQESQRE
EDAGEWQSFVALLKKYRTRQPINGVMVTISVADLLSDSAEARAAQASALRKRLIELHEQLGIHFPVYVLV
TKTDLLNGFMAYFGSFDKAQRDQIWGFTFPYERSRQPDFNLNAAFEQQYALLQQRLDAALPDTLLMEHDA
RQRAESYLFPQEFAALRPLLGHYLEQVFATSSFETRFTPRGIYFTSGTQEGLPFDRVMGELNRYLQLPTA
NSGAQANAAWDSVGQETPIPAAKGQSFFLKETLESVIFQESGLAGSNRWWEYRNRALHWAGYIALAVVLA
VLAMLWFTSYGNNKAYLAEVAAKVPGVERQGQNLTQVGNGDMFSLLPFLNSLLHLPDSQNFSLDDPPFTY
RMGLFRGDQVGDAGNALYQKALKELLLPQVAQQIATTLRNDNHGDADFSYEALKAYQMLYLPKQYDGKFL
RAWVMLNLQRNLPQGSTQKQLQQIEWHLSQLLDAQIQASPYAKDEQLVAQAQAAINRAPLSQRVYGRLKR
LLLKQTDIKPVSLVDLAGPQTELAFSRKSGKPVTDGVPGLFTSQGYWKAFNDNIDPVTDTLRKEDVWVLN
SQTPEQKSADLTKTIRQLYMQDFISAWDELLGDIQLANIGNLTQRISSARLLSGNPSPMRNLLVNVSKNV
TLRDEKSDADSRSLLAKTEDRLNQNANRTLEALFTNRPANADGDVSAQPEQLVMAHFAPLLELAQSQGEG
NKAIPFDSVLKQVDELYSYLTAVQGAANSGMSAPPSDIIPRLQAESGRLPVPFKQMLLSLAIGASSDTQR
KEMENVKKRISFEVGSFCRQAIAGRYPLVARARQEVTPDDLARMFAPNSGLMDSFFRDNLQGKVDTTRAN
WRFTPGVDGKTLPGGEGILRSFQQAQRIRDAFFANGTATPSYRVTVRPVRMDNDILNLTLDIDGQLFKYS
HGPQVPLVVSWPGTRNTNQVHLQLALANGTTASLVTSGPWALNRLVDMAQSSGTGGLGRQATFNLDGHRV
TLEFTPNSIRNPFQLPAFSCP
 
Nucleotide Sequence: 3636 bp     [Download]
>gi|448239774|ref|NC_020211.1|:3247396-3251031 Serratia marcescens WW4, complete genome
ATGCTCAGTACGTTATTCTCCATCATCACCAGCCGCCTGCTGTGGGGCTTTGTCGGCATTACCGCGCTGG
CGTTCATCATCTGGATGATCGGCCCGCTGGTGGCCATCGGCGACTATCGCCCGCTGGAGCCGGAACTCAA
CCGCCAGATCGCCATTGGCGTCATCTACCTGATCTGGTTCCTGTGCCGCCTGATCCCGCGCCTCTACAGC
GCCTGGTTCAACAGCCGCCTGCTGAGCAACCTGCGCGCCGCCGAAACGGTGCCGGCGGAAGACGGCAAGC
CCGAGGTTAAACAAGACGATCAGCTGGCGCAGCGCTTCGACGAAGCGGCGCAGCTGCTGAAAAAGGCGCG
CTTCGCACCGGGCCAGGGCGACGGCAAACACCGCTGGATGACCCGCTTTAGCCGCCAATACCTGTACCAA
CTGCCGTGGTATGTGATCATCGGCGCGCCCGGTGCCGGCAAGACCACCGCGCTGGTCAATTCCGGCCTGC
ACTTCCCGCTGGCGGATCGCTTCGGCAAATCCGCGCTGCGCGGCGTGGGCGGCACCCGCAACTGCGACTG
GTGGTTTACCAACGACGCCGTGTTGCTCGACACCGCCGGCCGCTACACCACCCAGGAAAGCCAGCGCGAA
GAAGACGCCGGCGAATGGCAAAGCTTCGTCGCGCTGCTGAAAAAATATCGCACCCGCCAGCCAATCAACG
GCGTGATGGTCACCATCAGCGTCGCCGATCTGCTGAGCGACAGCGCCGAAGCGCGCGCCGCCCAGGCCAG
CGCGCTGCGCAAACGCCTGATCGAACTGCACGAACAGCTGGGCATTCACTTCCCGGTCTATGTGCTGGTG
ACCAAAACCGACCTGCTCAACGGCTTTATGGCCTATTTCGGCAGCTTCGACAAAGCGCAGCGCGACCAGA
TCTGGGGATTCACCTTCCCTTACGAACGCTCGCGGCAGCCGGACTTCAACCTGAACGCCGCCTTCGAACA
GCAATACGCCCTGCTGCAACAACGGCTGGATGCGGCGCTGCCGGATACGCTGCTGATGGAGCACGACGCG
CGCCAACGCGCCGAAAGCTATCTGTTCCCGCAGGAATTCGCCGCGCTGCGCCCGCTGCTCGGCCACTATC
TGGAACAGGTGTTCGCCACCTCCAGTTTTGAAACCCGCTTTACCCCGCGCGGCATCTATTTCACCAGCGG
CACCCAAGAGGGGCTGCCGTTCGACCGGGTGATGGGCGAACTGAACCGCTACCTGCAGCTGCCGACGGCC
AACTCAGGGGCGCAGGCCAACGCGGCCTGGGACAGCGTGGGCCAGGAAACGCCGATCCCGGCAGCCAAAG
GCCAGAGCTTCTTCCTGAAAGAGACGCTGGAATCGGTGATCTTCCAGGAGTCCGGGCTGGCGGGCAGCAA
CCGCTGGTGGGAATACCGCAACCGCGCCCTGCACTGGGCGGGTTACATCGCGCTGGCGGTGGTCCTGGCG
GTGCTGGCGATGCTCTGGTTCACCAGTTACGGCAACAACAAGGCCTACCTGGCGGAAGTGGCCGCCAAGG
TGCCCGGCGTCGAGCGCCAGGGGCAAAACCTGACGCAGGTGGGCAACGGCGACATGTTCTCGCTGCTGCC
GTTCCTCAACAGCCTGCTGCACCTGCCGGACAGCCAGAACTTTTCGCTGGACGATCCGCCGTTCACTTAC
CGTATGGGGCTGTTCCGCGGCGATCAGGTCGGTGACGCCGGCAATGCCCTGTATCAAAAAGCGCTGAAAG
AGCTGCTGCTGCCGCAGGTGGCGCAACAGATCGCCACCACGCTGCGCAACGATAACCACGGCGACGCGGA
CTTCAGCTATGAAGCTTTGAAGGCCTATCAGATGCTGTATCTGCCGAAGCAGTACGACGGCAAATTCCTG
CGCGCCTGGGTGATGCTCAACCTGCAGCGCAACCTGCCGCAGGGCAGCACCCAAAAACAGCTGCAGCAGA
TCGAATGGCACCTGAGCCAACTGCTGGATGCGCAGATCCAGGCCTCGCCCTACGCCAAAGATGAACAGCT
GGTGGCGCAGGCGCAGGCCGCCATCAATCGGGCGCCGCTGTCGCAGCGCGTCTATGGCCGCCTCAAGCGC
TTGCTGCTGAAACAGACCGACATCAAGCCGGTCAGCCTGGTCGATTTGGCCGGCCCGCAGACCGAGCTGG
CGTTCAGCCGCAAAAGCGGCAAACCGGTCACCGACGGCGTGCCGGGCCTGTTCACCTCGCAAGGGTACTG
GAAAGCGTTCAACGACAACATCGATCCGGTGACCGATACCCTGCGCAAGGAAGACGTCTGGGTGTTGAAC
AGCCAGACGCCGGAGCAGAAGAGCGCCGATTTGACCAAGACCATCCGCCAGCTGTACATGCAGGATTTCA
TCAGCGCCTGGGATGAGCTGCTGGGGGATATCCAACTGGCCAACATCGGCAACCTGACCCAACGCATCAG
CAGCGCGCGCCTGCTGTCAGGCAACCCGTCGCCGATGCGCAACCTGCTGGTCAACGTCAGCAAAAACGTT
ACCCTGCGCGACGAGAAAAGCGACGCCGATTCCCGCTCGCTGCTGGCCAAAACCGAAGACAGGCTGAATC
AAAACGCCAACCGCACGCTGGAGGCGCTGTTCACCAACCGGCCGGCCAACGCCGACGGCGACGTGTCGGC
CCAGCCGGAACAGCTGGTGATGGCGCACTTCGCGCCGCTGCTGGAGCTGGCGCAAAGCCAGGGCGAAGGC
AATAAGGCGATCCCTTTCGACAGCGTGCTGAAACAGGTCGATGAGCTGTACAGCTACCTGACGGCGGTGC
AAGGCGCGGCCAACAGCGGCATGTCGGCGCCGCCGAGCGACATCATCCCGCGCCTGCAGGCCGAGTCCGG
CCGCTTGCCGGTGCCGTTCAAACAGATGCTGCTGTCACTGGCGATCGGCGCCAGCAGCGACACCCAGCGC
AAAGAGATGGAGAACGTGAAAAAGCGCATCAGCTTCGAGGTCGGCAGCTTCTGCCGCCAGGCGATCGCCG
GGCGTTATCCGCTGGTGGCCCGGGCGCGCCAGGAAGTGACGCCGGACGATTTGGCGCGCATGTTCGCGCC
GAACAGCGGGCTGATGGACAGCTTCTTCCGCGACAACCTGCAGGGCAAGGTCGACACTACCCGCGCCAAC
TGGCGCTTTACCCCCGGCGTGGACGGCAAGACGCTGCCCGGCGGCGAAGGCATCTTGCGTTCGTTCCAGC
AGGCGCAGCGCATCCGCGACGCCTTCTTCGCCAACGGTACCGCGACGCCCTCGTACCGCGTGACCGTGCG
GCCGGTGCGGATGGATAACGACATCCTCAACCTGACGCTGGATATCGACGGGCAGCTGTTCAAATACAGC
CACGGTCCGCAGGTGCCGCTGGTGGTCAGCTGGCCGGGCACCCGCAATACCAACCAGGTGCATCTGCAGC
TGGCGCTGGCCAACGGCACCACCGCCAGCCTGGTGACCAGCGGGCCGTGGGCGCTGAACCGCCTGGTGGA
TATGGCGCAGTCTTCGGGCACCGGCGGCCTCGGCCGTCAGGCGACGTTCAATCTCGACGGCCACCGCGTC
ACGCTGGAGTTCACGCCCAACAGCATTCGCAATCCGTTCCAACTGCCGGCCTTCTCGTGCCCGTAG
 Primer design