SecReT6
Protein ID: 448242905
SecReT6 ID731
T6SS typei3
Gene symbol-
Locus tagSMWW4_v1c31450
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3387021..3390500 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDL7ZP09
KEGG IDsmw:SMWW4_v1c31450
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.30E-74, Aligned region: 509..793
DUF1215 [PF06744], Evalue: 3.40E-30, Aligned region: 898..1018
ImcF-related_N [PF14331], Evalue: 1.60E-29, Aligned region: 196..372
ImcF-related_N [PF14331], Evalue: 1.60E-29, Aligned region: 816..867
AAA_16 [PF13191], Evalue: 0.0082, Aligned region: 118..139
AAA_16 [PF13191], Evalue: 0.0082, Aligned region: 190..232
AAA_16 [PF13191], Evalue: 0.0082, Aligned region: 277..333
AAA_16 [PF13191], Evalue: 0.0082, Aligned region: 821..821
Protein Sequence: 1159 a.a.     [Download]
>gi|448242905|ref|YP_007406958.1| type VI secretion protein IcmF [Serratia marcescens WW4]
MIRRSFILVIALLLCAVVWWIGTLIAIGTYRPLLSVWVRGIIIALILCWALWPFVATFLSWVFRHARAPA
PAKRKTAQRDRVTSRFYDALRTLQYVGTAKQRTPWQRFKYRLTRRYVSEKPWFLVIGPPGSGKTSLIGES
GERFLLAEHYGLQQTVDVGPTQDCNWWLAENSVYVDTSGEWLQLNGLGEEGARARDTLFKLIRRHRRHPG
IDGIMLCLDARWLLHASLTERKSVADALRVRLLEMASWFRSELPVYLTISHLDQLVGGETFLSMLGDDLL
QKGMGFSLNRAEQGETPFEQYETLYREMVARVSHHVLELLHDAPDGQNRQQLLFFTESLGSLGNPLYSLL
EQIFPQTPVGYACHLQQVWLGSTIALSPQGAIYNAEAADIYEARPTGRIYHPELDYARQERGVMQQSSHA
RPLGSRMSSLGRYVLVLILLAVSFNLLAMRYLWESDYISYIAARFDETKRIVREIPVTNRVSDDVISAYE
QLGYMNAQLGGEVSPVPNPYFEHKLINSAAQKTYQRHLLQIFWPAVENYIADELKNDVSASNKDVYGTLK
VYLMMGEPSHRSAEALVDWFMARWETFMPQGYTDMNKGIFAYHLREMFSLPDAPVMKMNGDLLRLARVKA
MNIPMQVRVVRRIEEKPLPAAINDISLADAAGPNVSLMLRRKSQATVTDTAVPGFYTRASYRDVFLAQLD
DAAKDMIEEESWVLRDSGEGKNAVNSLASAQKLADEARKLYLIEYADKWDAFMRDVRARPVNGLEDAAIL
ARQLSDPSSPLANLVRFAARETSMTGTNQGDAASWFDRQRNRIEQQRRDILGEISGERARFRLTPERAVE
DRFELLRRLGYQLLQTTNASNDPLSRSFEALYSQLTTLSTSLRGGQVVPAGGTLKRLQLDAARQPEPVRS
VMMDLLQVGDSQTIQQSQKNLSKGASSLASGLCKSSISGRYPFSRNARAEVGIEDFSRMFGQSGAMQQFF
DENLAPYVDVNAQKWNAKPGSEGIVNASTLGAFENARLIRDTFFTAGDKLSFSMFIRPLSLTPTITEATL
DIDGQVINYSHGFSQPTRIDWPGPKGGSYVRLTFRTGTGQIQVASFDGPWALFRMFDASNPVPLASDRRE
LTMSMSSVVGVLKLELRSTMKDFPLWSRALRGFSCPKAM
 
Nucleotide Sequence: 3480 bp     [Download]
>gi|448239774|ref|NC_020211.1|:c3390500-3387021 Serratia marcescens WW4, complete genome
ATGATACGTAGATCATTCATATTGGTGATTGCCTTGCTGCTGTGTGCGGTGGTGTGGTGGATTGGGACGT
TGATCGCCATCGGCACCTATCGGCCGCTGCTGTCGGTCTGGGTCAGGGGCATCATCATCGCGCTGATCCT
GTGCTGGGCGCTGTGGCCGTTCGTGGCGACGTTCTTATCCTGGGTGTTCCGCCACGCGCGAGCGCCGGCC
CCGGCCAAACGCAAGACCGCCCAGCGAGATCGCGTGACCTCGCGCTTTTACGACGCTTTGCGCACCTTGC
AGTACGTCGGCACGGCGAAGCAGCGCACCCCCTGGCAGCGCTTCAAATACCGCCTGACGCGCCGTTACGT
CAGCGAAAAGCCGTGGTTTCTGGTCATCGGGCCGCCGGGCAGCGGCAAAACCTCGCTGATCGGCGAAAGC
GGCGAACGCTTCTTGCTGGCCGAGCACTATGGCCTGCAGCAGACGGTGGACGTCGGGCCGACCCAGGATT
GCAACTGGTGGCTGGCGGAGAATTCGGTGTATGTCGACACTTCCGGCGAATGGCTGCAGTTGAACGGTCT
GGGGGAAGAGGGCGCCAGGGCGCGCGACACCCTGTTCAAACTGATCCGCCGCCATCGCCGCCATCCGGGC
ATCGACGGCATCATGCTGTGTCTTGATGCGCGTTGGTTGCTGCACGCCTCGCTGACGGAGAGAAAGTCGG
TCGCCGACGCGCTGCGCGTGCGCCTGCTGGAGATGGCCTCGTGGTTCCGCAGCGAGCTGCCGGTCTATCT
TACCATCAGCCACCTCGATCAACTGGTCGGCGGCGAGACCTTCCTGTCGATGCTGGGCGACGATCTGTTG
CAAAAAGGTATGGGCTTCAGCCTGAACCGCGCCGAACAGGGAGAAACCCCCTTCGAACAGTATGAAACCC
TCTACCGGGAGATGGTGGCGCGCGTCAGCCATCACGTGCTCGAACTGTTGCACGATGCGCCGGACGGCCA
AAACCGCCAGCAGCTGCTGTTCTTCACCGAGTCGCTGGGGTCGCTGGGCAACCCGCTGTATTCCCTGTTA
GAGCAGATCTTCCCGCAAACGCCGGTGGGCTACGCCTGCCATCTGCAGCAGGTGTGGCTGGGCAGCACCA
TCGCCTTGTCGCCGCAGGGGGCGATCTACAACGCGGAAGCGGCGGATATCTATGAAGCTCGCCCGACCGG
GCGCATTTATCACCCGGAGCTGGATTACGCCCGGCAAGAACGCGGGGTGATGCAGCAGTCTTCGCACGCC
AGGCCGCTCGGCAGCCGCATGAGCTCCCTGGGCCGCTATGTGCTGGTGCTCATTCTGTTGGCGGTCTCGT
TTAATCTGCTGGCGATGCGTTACCTGTGGGAGAGCGATTACATCTCCTACATTGCGGCGCGCTTCGATGA
GACAAAACGCATCGTGCGGGAAATTCCGGTGACTAACCGCGTCAGCGACGATGTCATTTCCGCCTATGAG
CAGCTGGGCTACATGAACGCGCAATTGGGCGGCGAAGTGTCGCCGGTGCCGAATCCCTATTTCGAGCACA
AGCTGATCAACAGCGCGGCGCAAAAAACCTACCAACGCCATTTGCTGCAGATCTTCTGGCCGGCGGTGGA
AAACTATATCGCGGACGAACTCAAGAATGACGTCTCGGCGTCCAACAAGGACGTCTACGGCACCCTGAAA
GTGTACCTGATGATGGGCGAACCTTCGCATCGCTCCGCCGAAGCCTTGGTCGACTGGTTCATGGCGCGCT
GGGAAACCTTTATGCCGCAGGGGTACACCGATATGAACAAAGGCATCTTCGCTTACCATCTGCGGGAGAT
GTTCTCTTTGCCGGACGCGCCGGTCATGAAGATGAACGGCGATCTGCTGCGCCTGGCGCGGGTGAAAGCG
ATGAACATTCCGATGCAGGTGCGGGTGGTGCGCCGCATCGAAGAGAAACCGCTGCCGGCGGCGATCAACG
ATATTTCGTTGGCCGACGCCGCCGGACCGAACGTCTCCTTGATGCTGCGCCGCAAGAGCCAGGCGACGGT
CACCGATACCGCCGTGCCGGGGTTCTATACCCGCGCCAGCTATCGCGACGTTTTCCTGGCGCAGCTCGAT
GACGCCGCCAAGGACATGATCGAAGAAGAGTCCTGGGTGCTGCGCGACAGTGGGGAAGGGAAAAACGCGG
TGAACTCGCTGGCCTCGGCGCAGAAGCTGGCCGACGAGGCGAGGAAGCTTTACCTCATCGAGTATGCCGA
CAAATGGGATGCGTTCATGCGCGACGTGCGCGCCCGGCCGGTCAACGGGCTTGAGGATGCGGCGATCCTG
GCGCGTCAACTGTCCGATCCTTCTTCTCCACTGGCCAATCTGGTGCGTTTCGCCGCGCGCGAAACCAGCA
TGACCGGCACCAACCAGGGCGATGCGGCAAGCTGGTTCGATCGCCAGCGCAACCGCATCGAGCAGCAGCG
GCGCGACATTCTGGGCGAGATTTCCGGCGAGCGCGCGCGTTTTCGTCTCACGCCGGAGCGCGCGGTGGAA
GATCGCTTCGAGCTGCTGCGCCGTCTGGGCTATCAGCTGTTGCAGACCACCAACGCCAGCAACGATCCGC
TGAGCCGCAGTTTCGAAGCGCTGTACAGCCAGTTGACCACCTTGTCCACCTCGCTGCGCGGCGGCCAGGT
GGTGCCCGCCGGGGGCACGCTGAAGCGCCTGCAGCTGGATGCGGCGCGCCAGCCGGAACCGGTGCGCAGC
GTGATGATGGATCTGTTGCAGGTCGGGGACAGCCAGACGATTCAGCAGAGCCAGAAGAACCTGAGCAAAG
GCGCTTCGTCGCTGGCCTCCGGCTTGTGCAAGAGCAGCATCAGCGGGCGTTATCCGTTCTCGCGCAACGC
CAGAGCGGAGGTCGGCATCGAGGACTTCTCGCGCATGTTTGGCCAAAGCGGCGCGATGCAGCAGTTCTTC
GATGAGAACCTGGCCCCTTATGTGGACGTCAACGCGCAGAAATGGAATGCCAAACCGGGTTCAGAGGGGA
TCGTCAATGCCAGCACGCTGGGCGCGTTTGAAAATGCCCGCCTGATCCGCGATACCTTCTTCACCGCCGG
CGACAAGCTGTCTTTCTCCATGTTCATCAGGCCGTTGTCCCTGACGCCGACTATTACGGAAGCGACCCTG
GATATCGATGGGCAGGTGATTAACTACAGCCATGGCTTCAGCCAGCCTACCCGTATCGATTGGCCGGGCC
CGAAAGGCGGCAGCTATGTTCGACTCACCTTCCGCACCGGCACCGGCCAGATCCAGGTCGCCAGTTTCGA
CGGGCCCTGGGCCTTGTTCCGGATGTTCGACGCCAGCAATCCCGTGCCGCTCGCCAGCGACAGGCGAGAG
CTGACGATGTCGATGTCGTCGGTGGTGGGCGTGCTCAAACTGGAATTGCGCTCGACGATGAAAGATTTCC
CACTTTGGTCACGGGCGTTGCGAGGATTCTCGTGCCCGAAAGCGATGTAA
 Primer design