SecReT6
Protein ID: 449310143
SecReT6 ID733
T6SS typei3
Gene symbol-
Locus tagCSSP291_18235
StrainCronobacter sakazakii Sp291
Repliconchromosome [GenBank: NC_020260] [Browse all T6SS(s) in this replicon]
Location [Strand]3900637..3904257 [-]
Producttype VI secretion system protein ImpL
NoteTssM
UniProt IDM1JPW4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 8.40E-102, Aligned region: 207..484
ImcF-related_N [PF14331], Evalue: 8.40E-102, Aligned region: 764..815
IcmF-related [PF06761], Evalue: 6.20E-88, Aligned region: 533..836
DUF1215 [PF06744], Evalue: 6.50E-32, Aligned region: 947..1072
AAA_16 [PF13191], Evalue: 0.00064, Aligned region: 142..275
AAA_16 [PF13191], Evalue: 0.00064, Aligned region: 835..913
Protein Sequence: 1206 a.a.     [Download]
>gi|449310143|ref|YP_007442499.1| type VI secretion system protein ImpL [Cronobacter sakazakii SP291]
MLNILLSIVTNRILWGFMGVTALSAVVWMIGPLLSIVDSRPLESETNRIISIALIYLIWVHSHIVPRLYN
AWLNRKLMDKLNEGKPAEEGGSDVKRLGNDDKVLADRFDEAAQILKKAHFNAPGQRGQWTQRFSTQYLYQ
LPWYVIIGAPGSGKTTALVNSGLQFPLADRFGKTALRGIGGTRNCDWWFTNEAVLLDTAGRYTTQESEQA
QDAGEWLSFVDLLRKYRRRQPINGVIITISVSDLLTQSPEATQQQAVNLRQRLAELHEQLGIRFPVYVLV
TKADLLKGFRSYFGRFDKAQRDQIWGFTFPWDRSKQADFDLLAAFTQEFALLQQRLDAGLPDTLLAESDP
KARAECYLFPQEFAALRPLLADYLSTVFARSNFETEFSPRGIYLASGTQEGLPFDRVMGELNRALSLPSG
GKEGDNWDSVSKEAPIPGGKGQSFFIKNLLQNVIFQEAGIAGQNRWWELRNRAVLWSGYAALIALLLILG
GLWLTSYGNNKDYLAEVNDKVPGVERQSKALQTTAGRDLFSMLPFFNSLVDLPKSKEFDLNSPPVTYRMG
LYRGDDVNDASQALYQKALQEMLMPAVAQLITGWVRSDNGSDVEYSYEALKAYQMLYQPKHYDGKFLHSW
VMLNLERNLPQNVTQAQLNQLEWHLTQLLEPQIQTSPYAKDESLISRQQAMINQKPLSLRVYGRLKRLLE
RDENLKPVSLATLGGPQSELVFSRKSGKPVSEGVPGLYTPKGYWESFNGQIDNVTASLHDDDTWVLGLTT
AQEDKTQTDNAVRQLYMRDFISQWDSYLADIQLNNSADLNQRINTARVLSSSNSPLRRLVMNLSQVLTLS
RAEPQAGEGEAKEQGNRATRTLEALFSDRESGATTAAAAPQTPEQVVTDHYAPIIELAQPLEKGGKAIVF
DDFIKQIDELYRYLTAVQDAANSGMPPPGGEAISRLQASAGRLPGGLQNMFSRMAVGASSDTQQRELENV
RKRISVEVGSFCRQAIAGRYPLVRSASSEVTPDDLARMFAPGTGLMDSFFRDNLTNKVDTTQQRWRFTPG
IDGKTLPGSEGVLRPFQQAQYIRDAFFANGATTPSYRVTVRTVRMDNDILTLSLDVDGQLLRYSHGPQAV
QLMSWPGSGGTNQVRMQLGLANGTTSTLVTNGAWALNRFFDRARIAPGAGSLSRQATFSVDGHSVTLEFT
PNSIRNPFQLPGFACP
 
Nucleotide Sequence: 3621 bp     [Download]
>gi|449306535|ref|NC_020260.1|:c3904257-3900637 Cronobacter sakazakii Sp291, complete genome
ATGCTGAATATTCTCCTTTCAATAGTGACCAACCGCATCTTGTGGGGGTTCATGGGCGTTACCGCGCTGT
CGGCGGTCGTCTGGATGATCGGGCCATTGCTGTCCATCGTCGACAGCCGCCCGCTGGAGTCGGAAACCAA
CCGTATCATCAGCATTGCGCTTATCTACCTGATTTGGGTTCATAGCCACATCGTGCCGCGGCTCTACAAC
GCCTGGCTGAACCGCAAGCTGATGGACAAACTCAACGAAGGCAAGCCTGCGGAAGAAGGCGGCAGCGACG
TTAAGCGCCTCGGCAATGACGATAAAGTGCTGGCGGACCGCTTTGACGAAGCGGCGCAGATCCTTAAAAA
AGCGCACTTCAATGCGCCGGGCCAGCGCGGCCAGTGGACGCAGCGCTTCAGCACGCAGTATCTCTATCAG
CTTCCGTGGTATGTGATTATCGGCGCGCCGGGTTCCGGTAAAACGACGGCGCTGGTCAACTCCGGCCTGC
AATTCCCGCTCGCCGATCGCTTTGGCAAAACGGCGCTGCGCGGCATTGGCGGCACCCGCAACTGCGACTG
GTGGTTCACCAACGAAGCGGTGCTGCTCGATACCGCAGGCCGTTACACCACGCAAGAGAGCGAACAGGCG
CAGGACGCCGGTGAATGGCTGAGCTTTGTCGATCTGCTGCGTAAATATCGCCGCCGCCAGCCGATTAACG
GCGTCATTATCACCATCAGCGTTTCTGATCTGCTGACCCAGTCGCCGGAAGCGACGCAACAGCAGGCCGT
CAACCTGCGCCAGCGTCTGGCGGAGCTGCATGAGCAACTCGGTATCCGCTTCCCGGTCTATGTGCTGGTG
ACCAAAGCGGACCTGCTGAAAGGCTTTCGTTCTTACTTTGGTCGCTTTGATAAAGCGCAGCGCGACCAGA
TCTGGGGCTTCACCTTCCCGTGGGATCGCTCAAAACAGGCCGATTTCGACCTGTTAGCGGCATTCACCCA
GGAGTTCGCGCTCCTCCAGCAGCGTCTGGACGCGGGCCTGCCGGATACCCTGCTCGCGGAAAGCGACCCG
AAAGCGCGCGCCGAGTGTTATCTGTTCCCGCAGGAGTTCGCGGCGCTGCGTCCGCTGCTCGCGGATTACC
TCAGCACCGTTTTTGCCCGCTCTAACTTTGAAACCGAATTCTCGCCGCGCGGGATTTATCTCGCGAGCGG
CACCCAGGAAGGGCTGCCGTTTGACCGTGTCATGGGTGAACTCAACCGCGCGCTGTCGCTGCCGTCCGGC
GGCAAAGAGGGCGACAACTGGGATTCGGTGAGCAAAGAAGCGCCGATCCCCGGCGGTAAAGGACAGAGCT
TCTTTATTAAGAACCTGCTCCAGAACGTGATTTTCCAGGAAGCGGGCATCGCCGGGCAGAATCGCTGGTG
GGAGCTGCGCAACCGCGCGGTGCTGTGGTCTGGCTACGCGGCGCTGATAGCGCTGTTACTGATCCTGGGC
GGCCTGTGGCTCACCAGCTATGGCAACAACAAAGACTATCTGGCGGAAGTGAACGATAAAGTGCCGGGCG
TCGAACGCCAGAGTAAAGCGCTGCAAACCACCGCCGGGCGCGATCTCTTCAGCATGCTGCCGTTCTTTAA
CAGCCTGGTGGATCTGCCAAAGAGTAAAGAATTTGACCTGAACTCGCCGCCGGTGACGTACCGCATGGGG
CTTTATCGCGGCGATGACGTTAACGACGCTTCGCAGGCGCTCTACCAGAAAGCGCTGCAGGAGATGCTGA
TGCCTGCCGTGGCGCAGCTCATCACCGGCTGGGTGCGCAGCGACAACGGCAGCGACGTGGAATACAGCTA
CGAAGCGCTGAAGGCGTACCAGATGCTCTACCAGCCGAAGCACTACGACGGCAAATTCCTGCACTCCTGG
GTAATGCTCAATCTTGAGCGCAACCTGCCGCAAAACGTCACCCAGGCGCAGCTTAACCAGCTCGAATGGC
ACCTGACGCAACTGCTGGAGCCGCAGATCCAGACCTCGCCATACGCCAAAGATGAGTCCCTGATCAGCCG
CCAGCAGGCGATGATCAACCAGAAACCGCTGTCGCTGCGCGTCTATGGCCGCCTCAAACGCTTGCTGGAG
CGCGATGAAAACTTAAAGCCGGTATCGCTCGCCACCCTCGGCGGCCCGCAGAGCGAGCTGGTCTTTTCGC
GTAAAAGCGGCAAACCGGTGAGCGAAGGCGTGCCGGGGCTTTACACCCCGAAAGGCTACTGGGAAAGCTT
CAACGGCCAGATTGATAACGTCACCGCCTCGCTGCATGACGATGACACCTGGGTGCTCGGGCTGACCACC
GCGCAGGAAGATAAAACGCAGACGGACAACGCGGTGCGCCAGCTCTATATGCGCGACTTTATCAGCCAGT
GGGACAGCTACCTGGCGGATATTCAGCTTAACAACAGCGCCGATCTAAACCAGCGCATCAACACGGCCCG
CGTGCTTTCCAGCAGCAACTCGCCGCTGCGCCGTCTGGTGATGAACTTAAGCCAGGTGCTGACGCTCTCC
CGCGCCGAACCGCAGGCGGGCGAAGGGGAAGCGAAAGAGCAGGGCAACCGCGCGACCCGCACGCTGGAGG
CACTCTTCAGCGACCGCGAAAGCGGGGCGACCACCGCCGCCGCCGCGCCGCAGACGCCGGAACAAGTGGT
GACCGATCACTACGCGCCGATTATCGAACTGGCGCAGCCGCTGGAGAAAGGCGGCAAAGCCATCGTGTTT
GATGACTTTATTAAGCAGATCGATGAGCTTTACCGTTATCTGACCGCCGTACAGGACGCCGCCAACAGCG
GTATGCCACCGCCGGGCGGCGAAGCCATCAGCCGTTTACAGGCGAGCGCCGGGCGTCTGCCGGGCGGGCT
GCAAAATATGTTCAGCCGCATGGCGGTAGGGGCGAGCAGCGACACCCAGCAGCGCGAACTGGAAAACGTC
CGCAAGCGTATCAGCGTGGAAGTCGGCAGCTTCTGCCGCCAGGCGATTGCCGGCCGGTACCCGCTGGTGC
GCTCCGCCAGCAGCGAAGTGACGCCGGACGATTTGGCGCGCATGTTCGCGCCGGGCACCGGCCTGATGGA
CAGCTTCTTTCGCGATAACCTGACGAATAAAGTCGATACCACCCAGCAGCGCTGGCGCTTTACGCCAGGC
ATCGACGGCAAAACGCTGCCGGGCAGCGAAGGGGTGCTGCGTCCGTTCCAGCAGGCGCAATACATTCGCG
ACGCGTTCTTCGCCAACGGCGCGACCACGCCGTCTTATCGCGTGACGGTGCGCACCGTGCGGATGGATAA
CGACATTCTGACGCTGTCGCTCGACGTTGACGGCCAGCTTCTGCGTTACAGCCACGGCCCGCAGGCGGTG
CAGCTGATGAGCTGGCCGGGCAGCGGCGGCACGAATCAGGTGCGTATGCAGCTCGGGCTTGCCAACGGCA
CCACCTCGACGCTCGTGACCAACGGCGCGTGGGCGCTGAACCGCTTTTTCGATCGCGCCCGCATTGCGCC
GGGTGCAGGAAGCCTGAGCCGCCAGGCGACGTTTTCGGTTGACGGACACAGCGTGACGCTGGAATTCACG
CCGAACAGTATCCGCAACCCATTCCAGCTCCCTGGCTTCGCATGCCCTTAA
 Primer design