SecReT6
Protein ID: 451948301
SecReT6 ID735
T6SS typei1
Gene symbol-
Locus tagUWK_02707
StrainDesulfocapsa sulfexigens DSM 10523
Repliconchromosome [GenBank: NC_020304] [Browse all T6SS(s) in this replicon]
Location [Strand]3018704..3022519 [-]
Producthypothetical protein
NoteTssM
UniProt IDM1P6Z5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 6.60E-63, Aligned region: 184..440
AAA_16 [PF13191], Evalue: 0.0012, Aligned region: 108..199
AAA_16 [PF13191], Evalue: 0.0012, Aligned region: 293..328
AAA_16 [PF13191], Evalue: 0.0012, Aligned region: 759..858
Protein Sequence: 1271 a.a.     [Download]
>gi|451948301|ref|YP_007468896.1| hypothetical protein UWK_02707 [Desulfocapsa sulfexigens DSM 10523]
MKKIMLAAFKFLLLTSLLLLIATATFGLVLWAKWPWWIGLFFLLGYVGLYLGWIFFRKILLRKREQNFVH
QVIEQDNAYIKGAGSGQEGLQELQGRWQEAIEILKSSHLSKQGNPLYVLPWYMVIGESRSGKSTAIKSAD
LSAPFAETSKIGGVAGTRNCDWWFFEQAVILDTAGRYTIPLEEGRDKDEWQKFLSLLVKYRRKEPLNGLV
VTIAADKLLQADDDRIAEDGRNIRQRIDELMRVLGKVFPVYVLITKCDLVQGMTQFCDRLPDKSLEQAMG
LINRNHKDIRTFLQDVDSTIGDRLQQLRLQLLHGKQDPSRKQSQSAADLLLFPNEFKILHRRLSSFIEST
FKANPYQESPILRGLYFSSGRQEGTPFSNFLHALGLIKQQDVLPGTNKGLFLHDLFSRILPEDRTLFAPT
QKALAWNRLTRNIGLTAWAAIIFTLCGLLSFSFVKNLTTLQNGTEAFKQSVVLQGDFLTDTALMERFQKA
ISTMEDYNRAWWIPRFGLNKSEDIELRLKQKYCHRFNSEFNERLNIQLDTAVSALTPGSSDVIIGTVVAH
LVHRINLIQARLDNKDPSSFDQQAQPSFQALFGGEDRRLIADLSDRVLLQYHHYLNWQESSETLNLEKER
LQRALLHILSMPDTSLNWLVSWVNHNSDSSALNVQDFWSSPLTRKNIATVPPAFTIKGRDIINTLLEDIG
TALPDPLLITSNKARFQKWYEMAYRLVWYDFAEKFPQAEYYLGDGSSWQEVATTMATDQNPYFSLLRTMA
RELAPLEEDEKENTWILLINQIEQARIDATREAAIEESNSLLAKVTKKGKKALGSLEKKTGLDPSGILSS
QLAAGKLFNSYQMALKDITLASSSRTVSYSMAAEIFKDDPATSKSPFYLAKHHLVAFRKELSQPGQQQKV
VWRLLAGPLTFLRDYTCLEAACHLNSLWEKNVLVEVQDITDKTKLNDELFLDDGYAIRFIKGPAAPFLGR
SLKKGFYPKTALGKMLPFEKEFLDFLTDGIRLVRFKPDLSFSEEVPLDMQLEADAVFGAQPEKKKEPEIP
PLPTINANYDILVTANPTSVNKEARITPHVTTLESVCGAETTRLVNLNYPIRKKMSWQPENCESVSLQIE
IGSLILKKKYEGKLAFAHFAKDFQNGSHLFSVNDFPDQKKQLVRLRITTIKVNFQLKGGQPLISIIDQQE
KREKFLAELEEKRKMQAADSSKGIKELLATWERKQKMTALENEALKKSWKARQQAEAQKIKQNWEQKLPD
VPTDITNCWDN
 
Nucleotide Sequence: 3816 bp     [Download]
>gi|451945650|ref|NC_020304.1|:c3022519-3018704 Desulfocapsa sulfexigens DSM 10523, complete genome
ATGAAAAAGATAATGCTCGCCGCCTTTAAATTCCTCTTACTGACAAGCCTTCTGCTTCTGATCGCTACTG
CTACCTTTGGCCTGGTTCTCTGGGCAAAATGGCCATGGTGGATCGGACTCTTTTTTCTACTTGGCTATGT
TGGTCTCTATCTCGGCTGGATATTTTTTCGGAAAATCCTCCTCCGAAAAAGGGAACAGAATTTTGTCCAT
CAGGTTATCGAACAGGACAATGCCTATATCAAAGGAGCGGGAAGTGGCCAGGAAGGATTACAGGAGCTTC
AGGGACGATGGCAGGAAGCAATTGAAATTCTCAAATCCTCCCACCTGAGCAAACAGGGCAACCCTCTCTA
TGTCCTGCCATGGTATATGGTTATCGGGGAGTCACGCTCTGGAAAATCAACGGCTATCAAGAGTGCAGAT
CTTTCTGCGCCCTTTGCTGAAACCAGTAAAATTGGAGGTGTTGCCGGCACACGAAACTGTGACTGGTGGT
TCTTTGAACAGGCAGTCATCCTCGACACCGCCGGACGCTATACCATACCACTGGAAGAAGGACGTGATAA
GGATGAATGGCAGAAGTTTCTCTCCCTGTTGGTCAAATATCGCAGAAAAGAACCCCTCAATGGTCTGGTA
GTAACTATAGCAGCAGACAAGTTGCTGCAGGCAGATGATGATCGCATTGCCGAGGATGGTCGAAACATCA
GGCAACGCATTGATGAGCTGATGCGGGTTTTAGGGAAAGTTTTTCCTGTCTATGTTCTCATCACCAAGTG
TGATCTGGTGCAGGGTATGACGCAGTTCTGTGACCGTCTGCCCGACAAGAGCCTTGAACAGGCCATGGGA
CTGATAAACAGGAATCACAAGGATATCAGAACATTTCTTCAGGATGTGGACTCTACCATTGGTGACCGTC
TTCAGCAATTACGTCTGCAACTGCTTCACGGTAAACAGGATCCCAGCCGCAAACAATCTCAATCCGCGGC
GGATCTTCTTCTTTTTCCCAACGAATTTAAAATTCTCCACAGGCGACTCTCCTCCTTTATCGAGTCCACC
TTCAAGGCAAACCCCTACCAGGAATCCCCCATTCTGCGAGGGCTCTATTTCAGCAGTGGTCGCCAGGAAG
GAACCCCTTTCTCCAACTTTCTCCATGCTCTTGGCTTGATCAAACAGCAGGACGTCCTGCCTGGCACCAA
TAAAGGACTCTTTCTCCATGATCTTTTTTCCCGTATCCTCCCCGAAGACCGTACCCTCTTTGCCCCGACC
CAAAAAGCTCTTGCCTGGAATCGGTTGACACGCAACATTGGTCTTACAGCCTGGGCTGCCATAATCTTTA
CCCTTTGCGGCCTGTTAAGTTTCTCATTTGTTAAAAATCTGACCACACTGCAAAACGGTACTGAGGCTTT
CAAACAATCCGTCGTCCTCCAGGGTGACTTCCTTACCGATACAGCACTGATGGAACGTTTCCAGAAGGCC
ATCAGTACCATGGAAGACTACAACAGAGCCTGGTGGATTCCCCGCTTCGGGTTAAATAAAAGTGAGGACA
TCGAACTCCGTCTCAAACAGAAATACTGCCATCGCTTCAACAGCGAGTTCAACGAAAGACTCAACATACA
ACTTGACACCGCTGTCTCCGCGTTAACACCTGGATCATCTGATGTTATTATTGGTACCGTTGTTGCCCAT
CTTGTGCACCGTATCAACCTGATTCAGGCCCGGCTTGACAACAAGGACCCATCAAGTTTTGATCAGCAGG
CACAGCCCTCTTTTCAGGCTCTTTTCGGGGGAGAAGACAGGCGTCTCATAGCCGATCTCAGTGACAGGGT
TCTCCTGCAATATCACCACTACCTGAATTGGCAGGAGAGCAGTGAAACACTTAATCTGGAAAAAGAACGT
CTACAGCGTGCACTCCTTCATATCCTTAGTATGCCCGACACCAGCCTCAACTGGCTGGTCTCATGGGTCA
ACCATAATTCCGATTCAAGCGCGCTGAACGTCCAGGACTTCTGGAGCTCCCCCCTGACCCGAAAAAATAT
CGCAACGGTACCACCTGCCTTCACCATCAAGGGGAGAGATATAATCAATACCCTGCTCGAAGATATCGGT
ACGGCATTGCCGGATCCTCTTTTGATCACCAGCAATAAAGCACGTTTTCAAAAGTGGTACGAGATGGCCT
ACAGGCTGGTATGGTATGATTTTGCTGAAAAATTCCCCCAGGCTGAATACTATCTGGGTGATGGTTCTTC
CTGGCAGGAAGTCGCCACTACCATGGCTACAGATCAGAACCCCTATTTTTCCCTGCTGCGAACCATGGCC
AGAGAACTTGCCCCTCTGGAAGAAGATGAAAAAGAAAATACCTGGATTCTTCTTATCAATCAGATAGAAC
AGGCTCGTATTGATGCCACACGAGAAGCTGCCATCGAAGAAAGTAATTCTCTGCTTGCCAAGGTAACAAA
AAAGGGGAAAAAGGCACTCGGCAGCCTTGAAAAGAAAACCGGTCTTGATCCAAGCGGAATCCTTTCCAGT
CAGCTTGCTGCAGGGAAGTTATTCAACAGTTATCAGATGGCTCTAAAAGACATTACCCTGGCTAGCTCCT
CTCGCACGGTCTCCTACAGTATGGCTGCTGAAATTTTCAAAGACGACCCTGCCACTTCAAAGTCCCCCTT
CTATCTTGCCAAACATCATCTCGTGGCTTTCCGGAAAGAGCTGAGCCAACCCGGCCAGCAACAGAAAGTG
GTCTGGCGGCTTCTTGCTGGCCCACTCACCTTTCTTCGAGATTATACCTGCCTGGAGGCTGCCTGTCACT
TAAACAGCCTGTGGGAAAAGAATGTACTTGTGGAAGTTCAGGATATAACAGACAAGACAAAACTGAACGA
TGAGCTCTTTCTCGATGACGGCTATGCCATTCGTTTCATCAAAGGACCAGCTGCCCCATTTCTTGGCAGG
AGCCTCAAAAAGGGGTTTTATCCAAAAACAGCCCTGGGTAAAATGCTCCCCTTCGAAAAAGAATTCCTGG
ATTTTCTCACTGACGGCATCCGCCTCGTCCGTTTCAAGCCTGATCTTTCCTTCAGCGAAGAAGTACCTCT
TGATATGCAGCTTGAAGCAGATGCTGTTTTCGGAGCTCAACCGGAAAAGAAAAAGGAACCCGAGATTCCT
CCTCTGCCAACTATTAATGCAAACTATGACATACTGGTAACTGCCAATCCGACCAGCGTTAACAAGGAGG
CAAGAATCACCCCCCATGTCACAACACTGGAGTCCGTATGCGGTGCAGAAACCACGCGTTTGGTCAATTT
AAATTATCCAATACGTAAAAAGATGTCATGGCAACCTGAAAATTGTGAATCAGTTTCTCTGCAGATTGAA
ATAGGCAGTCTTATTCTAAAGAAAAAATATGAGGGCAAACTTGCCTTTGCCCACTTTGCCAAAGATTTCC
AGAATGGAAGTCATCTTTTTTCAGTAAACGATTTTCCTGACCAGAAGAAACAGTTGGTCCGACTGCGGAT
TACAACTATCAAGGTCAACTTTCAACTCAAAGGCGGACAACCACTTATCAGCATTATCGATCAGCAGGAA
AAAAGGGAGAAGTTCCTTGCCGAACTTGAGGAAAAGCGCAAAATGCAGGCAGCAGACAGTAGCAAGGGCA
TCAAGGAACTTCTTGCAACATGGGAACGGAAACAGAAAATGACTGCTCTTGAGAATGAAGCTTTGAAGAA
ATCCTGGAAGGCAAGACAACAGGCTGAGGCCCAGAAAATAAAACAAAACTGGGAACAAAAACTTCCTGAC
GTTCCCACTGATATAACAAACTGTTGGGATAACTAA
 Primer design