SecReT6
Protein ID: 45443396
SecReT6 ID59
T6SS typei3
Gene symbolicmF3
Locus tagYP_3664
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]4169452..4172946 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ8CKD9
KEGG IDypk:y3658, ypm:YP_3664
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 8.00E-75, Aligned region: 498..796
DUF1215 [PF06744], Evalue: 5.20E-30, Aligned region: 905..1024
ImcF-related_N [PF14331], Evalue: 3.60E-29, Aligned region: 95..114
ImcF-related_N [PF14331], Evalue: 3.60E-29, Aligned region: 194..375
Protein Sequence: 1164 a.a.     [Download]
>gi|45443396|ref|NP_994935.1| hypothetical protein YP_3664 [Yersinia pestis biovar Microtus str. 91001]
MIRRMLILIIALVLCYIVWWIGPLIAIGPYFPLGGVWVRKIIIALILFWALWPFVAIFFSWIFRYARAPL
PKRKKKTVQLDRVSARFHDAMLTLQHADLSSQKTRWQRWRQRRKRQYIDAKPWFLVMGPPGCGKTSIVYE
SSEKFLLSEQYGLAQTTDIGPTQDCNWWLTDRAVYIDTAGEWILLHGQSEEAGTARQKLFSMIRKYRRYP
GVDGIVLCLDVSVLLNSSVTERKSLADTLRLRILEVASTFQADIAVYLFLNNIDKLPGGETFLSLMNDEL
LAGGLGISMTHNEKGQNNFVADEERYRELLTRVSRYVLEILHDSPNMEMRHQLLLFTESLGALQKPLFGL
FEQIFPATPIGYTGCLRQFWFGSTQNLTSWEALYYPSSTSTFESRPAGQMYFPALSQAITERGVLHATGP
MPLRNRLLNIGKYVFVVLVLCILLLMLSARYFWEYDYIGYATARFEETRRIVRDIPITNQVNDNLVAAYE
QLGYINTHYLESSPPLLTPYFEHRLLNQAMLQTYHRHLNKVFWPAVQNYVTNELKKDTQSPDGDNYDTLK
VYLMLGQPDHRSQEALVQWFMSRWESFAPQGYGQNDRKLFSYHLSELFSDTASAAPKVKLNDELIRESRI
KAMKTPIHIRVINRIHDAPLPARIEDLSLADAAGPSVTLMLRRKSPSTVTDLAIPAFYTRASYHDVVNPQ
LQEASEAMINEEAWVLSDGKASVSQVSLLAAAQKLSDEARKYYLMEYANQWDAFFNDIRVRPINGLDDAA
LLARQLSDPSSPLANLVRFSTREITLTTDNNGKGAMSSGWFNIQRNKLTTARRNIIDEMSGERSRFRLTP
EKAVEDRFELLRRLGYALQSASTSNSDPLGRTFEQIYNQLITLSTSLRAGQILPQNNDFSRLQIDMARQP
EPVRSIMMDLLAVGQTQSLQQSKANLSKGVSSIASDLCSNAVSGRYPFNRLASEEIGIGDFNRMFGRSGA
MQSFFDQNLAPYVDTNGNRWKVKPDSNGVVTPKTLRSFENSAQIRDTFFDASGKMAMSMIIRPISLTPSI
LEAVLDVDGQIINYSHGSNQPVKVDWPGPKGGVYIRLTFKTQDGNVETVSFNGPWAIFRMYDVSNPRPLG
VNSRELMMVMDNVSGVFKIELSSTMKDYPLWSKALAQFSCPKNL
 
Nucleotide Sequence: 3495 bp     [Download]
>gi|45439865|ref|NC_005810.1|:c4172946-4169452 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
ATGATACGCAGAATGTTGATTTTAATCATTGCCCTAGTGCTTTGTTATATTGTGTGGTGGATAGGGCCGC
TGATCGCCATTGGCCCCTATTTCCCTCTGGGGGGGGTATGGGTTCGTAAGATCATTATTGCTCTGATTTT
ATTTTGGGCACTGTGGCCATTTGTTGCAATTTTCTTCAGTTGGATTTTTCGTTATGCCCGTGCGCCACTT
CCCAAGCGCAAGAAAAAAACGGTTCAGCTTGATCGCGTTTCTGCACGTTTTCATGATGCGATGCTCACCC
TGCAACATGCGGATCTTTCAAGCCAGAAAACACGCTGGCAGCGCTGGCGTCAACGGCGTAAGCGCCAGTA
TATCGATGCTAAACCGTGGTTTCTGGTCATGGGGCCACCCGGATGCGGTAAAACGTCGATAGTTTATGAG
AGTAGCGAGAAGTTCCTACTCTCAGAACAGTATGGTTTAGCGCAGACCACGGATATTGGACCGACGCAGG
ACTGTAATTGGTGGCTGACGGATCGTGCTGTTTACATCGATACGGCAGGGGAATGGATCCTGCTGCATGG
TCAGAGCGAAGAAGCGGGCACGGCTCGGCAAAAATTGTTCTCTATGATCCGCAAATATCGCCGTTATCCG
GGGGTTGATGGGATTGTTCTTTGCCTTGACGTCAGCGTGCTTTTGAACTCTTCGGTGACGGAACGTAAGT
CACTGGCTGATACGTTGCGCCTGCGGATCCTGGAAGTTGCCTCGACATTTCAGGCCGATATTGCGGTGTA
CTTGTTCCTCAACAATATCGATAAGTTACCTGGCGGCGAAACCTTCCTCTCGTTAATGAACGACGAACTT
CTGGCCGGAGGGCTTGGGATTAGCATGACCCATAATGAAAAGGGGCAGAACAATTTCGTTGCCGATGAAG
AACGTTACCGTGAACTCCTGACACGTGTTAGCCGTTATGTGTTGGAAATACTGCACGATTCGCCCAACAT
GGAGATGCGCCACCAATTGCTGCTGTTTACAGAAAGCCTGGGAGCGCTACAAAAACCCCTGTTTGGCTTA
TTCGAACAAATATTTCCGGCGACACCGATTGGCTATACCGGTTGTTTGCGGCAGTTCTGGTTTGGCAGTA
CCCAAAATCTGACCTCATGGGAGGCGCTGTATTATCCGTCATCGACCAGCACCTTTGAAAGCCGGCCTGC
TGGGCAGATGTATTTCCCTGCACTGAGTCAAGCGATCACCGAAAGGGGGGTATTACACGCCACTGGCCCC
ATGCCTTTGCGAAATCGCCTGTTAAACATCGGTAAATATGTGTTCGTGGTCCTTGTGCTCTGCATCTTAT
TGTTGATGCTGAGCGCCCGCTATTTTTGGGAATATGACTATATTGGCTATGCGACAGCTCGGTTTGAGGA
AACCCGTCGGATTGTGCGTGACATCCCAATCACGAATCAGGTCAACGATAATCTGGTCGCAGCTTACGAA
CAGTTGGGGTATATCAACACCCATTATCTGGAAAGTTCACCGCCACTGCTGACACCGTACTTCGAGCACC
GTTTACTGAATCAGGCGATGTTGCAAACCTACCATCGTCACCTGAATAAAGTGTTCTGGCCTGCGGTACA
AAACTACGTCACCAACGAGCTGAAAAAGGACACTCAATCTCCTGACGGTGACAACTATGACACGCTGAAA
GTTTACCTGATGCTCGGACAACCTGATCACCGCTCTCAGGAGGCATTGGTGCAATGGTTTATGTCGCGCT
GGGAAAGTTTTGCGCCTCAGGGATATGGGCAAAACGACCGCAAACTCTTCAGTTATCATTTGAGTGAACT
GTTTTCTGACACCGCCTCAGCTGCCCCGAAAGTTAAGCTGAATGATGAGCTGATCCGTGAATCACGCATT
AAAGCGATGAAAACACCGATACACATCCGGGTGATTAATCGTATTCATGACGCCCCACTGCCCGCGAGGA
TTGAGGATCTTAGTCTGGCGGATGCCGCCGGTCCTAGCGTAACACTGATGCTGAGACGTAAAAGCCCCAG
TACAGTAACGGATTTGGCGATCCCGGCTTTCTACACTCGGGCCAGCTACCACGATGTGGTTAACCCACAA
CTTCAGGAAGCATCGGAAGCGATGATTAACGAGGAAGCGTGGGTGTTGAGTGACGGTAAAGCTTCGGTTA
GTCAGGTTAGTTTACTGGCTGCGGCGCAAAAACTGTCCGATGAAGCGCGCAAGTATTATCTGATGGAGTA
TGCCAACCAATGGGATGCATTCTTCAATGATATCAGGGTGCGCCCAATCAACGGACTTGATGATGCGGCG
CTGCTGGCAAGGCAACTCTCAGACCCGTCATCCCCGTTGGCTAATCTGGTGCGTTTCTCCACACGGGAAA
TAACCCTGACCACTGACAACAATGGTAAAGGGGCGATGTCGTCAGGCTGGTTCAATATTCAACGTAATAA
GCTCACGACTGCCCGCCGTAACATCATTGACGAAATGTCGGGTGAGCGTTCTCGTTTTCGTCTAACGCCA
GAGAAAGCGGTGGAGGATCGCTTTGAACTATTAAGACGTCTGGGATATGCCCTGCAAAGTGCGTCTACCA
GCAATTCTGATCCGTTGGGCCGAACCTTCGAGCAGATTTATAACCAGTTGATAACACTCTCGACTTCCCT
TCGGGCTGGGCAGATTTTGCCGCAAAATAACGATTTCAGTCGCTTGCAAATCGATATGGCCCGTCAGCCA
GAGCCGGTGCGCAGCATTATGATGGATCTGCTGGCCGTCGGACAAACGCAAAGTCTGCAACAAAGTAAGG
CCAACCTCAGCAAGGGCGTCTCTTCAATTGCTTCTGATTTATGTAGCAACGCCGTCAGTGGCCGTTATCC
CTTTAATCGGTTGGCTAGCGAAGAGATAGGTATTGGCGATTTCAACCGTATGTTTGGTCGTTCTGGGGCG
ATGCAAAGCTTCTTTGATCAGAATCTCGCACCGTATGTCGATACCAACGGCAACCGCTGGAAGGTAAAAC
CTGACAGTAACGGTGTGGTGACCCCTAAAACTCTGCGTTCGTTTGAAAACTCAGCACAAATCCGCGACAC
CTTCTTTGATGCCTCCGGCAAGATGGCGATGTCGATGATCATTCGCCCTATCTCACTGACTCCATCAATT
TTGGAAGCGGTTCTTGATGTCGATGGCCAGATTATTAACTACAGCCATGGTTCTAACCAACCGGTAAAAG
TTGATTGGCCAGGACCGAAAGGTGGGGTGTATATCCGCCTGACGTTCAAAACTCAGGATGGAAATGTGGA
AACCGTTAGCTTCAATGGTCCGTGGGCTATTTTCCGCATGTATGACGTTAGTAACCCTAGGCCACTCGGG
GTCAATAGCCGTGAACTCATGATGGTGATGGATAACGTGAGTGGCGTCTTCAAAATTGAGTTGAGTTCCA
CCATGAAAGATTATCCGCTGTGGTCAAAAGCATTGGCACAGTTCTCATGTCCTAAGAATCTCTAA
 Primer design