SecReT6
Protein ID: 45443397
SecReT6 ID59
T6SS typei3
Gene symbol-
Locus tagYP_3665
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]4172955..4174592 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ8CKD8
KEGG IDypk:y3659, ypm:YP_3665
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.80E-43, Aligned region: 8..32
DUF2077 [PF09850], Evalue: 3.80E-43, Aligned region: 152..347
OmpA [PF00691], Evalue: 1.30E-12, Aligned region: 407..510
Protein Sequence: 545 a.a.     [Download]
>gi|45443397|ref|NP_994936.1| hypothetical protein YP_3665 [Yersinia pestis biovar Microtus str. 91001]
MGLATRKARMNEFERQIRAAISAARNGAKHAEQSLTTPMWQAKSTVASLGGIVPRSGSSSTSQAENYKEG
LADQAASGNNMARTSAPPVTLYQQQPNANDSYPNGNNNNPNGDNNNPNGSNNNIARVQRMPHGISRGLYE
RPGMLLGAWDNAYIAAAMPLLLLVENIRSWPTRNAAEVRPPIVRELQYFQQHLQKKNYPQEDINHLSYLL
CTYIDGIFNGLQTPDSYNQSLLVEFHRDAWGGEDCFEHLRVYMNSPKQYREVLEFYDLIMCLGFDGKYQM
IEHGAVLLMDLRSRLHTQLYGQDATQSLAIAQAVKGSPRRQYIKALKIFTYGFALCLCAYGVTAWYLHQQ
SQQIRSNILTWVLPEPRKINIMETLPNPLSNILNEGWLEVRKDPRGWLLIFTSDGAFRTGEATLSEEFIN
KKNIERLGLALAPWPGDIEVIGHTDNKPFRSTSGNNNLKLSAARASVVADKLRESTQINETHQREISAIG
RGESDPLADNATEEGRKRNRRVDILWKIGQRDADKAMKQFLENPTPEVQGTNTQQ
 
Nucleotide Sequence: 1638 bp     [Download]
>gi|45439865|ref|NC_005810.1|:c4174592-4172955 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
ATGGGGCTTGCGACAAGGAAGGCTCGGATGAACGAATTTGAACGCCAGATCCGTGCAGCCATTTCCGCAG
CACGCAATGGCGCAAAACATGCGGAACAGTCACTGACTACACCAATGTGGCAAGCCAAAAGCACCGTAGC
CTCATTGGGTGGGATTGTCCCTAGAAGTGGCTCTTCGTCAACGTCACAGGCGGAGAACTATAAGGAAGGT
CTCGCGGACCAGGCTGCCTCGGGCAACAACATGGCGCGCACGAGTGCGCCACCGGTCACTTTGTATCAGC
AACAGCCAAATGCGAATGACAGCTATCCAAACGGGAATAACAACAATCCAAACGGGGATAACAACAATCC
AAACGGGAGTAACAACAATATAGCGAGAGTACAGCGTATGCCGCATGGCATTTCCAGGGGCTTATATGAG
CGCCCTGGGATGTTATTGGGTGCCTGGGATAACGCCTATATTGCTGCGGCTATGCCTTTGCTGCTGCTGG
TGGAAAATATTCGTAGCTGGCCGACGCGTAACGCCGCAGAGGTCAGGCCACCGATTGTGCGGGAATTACA
ATATTTCCAGCAACATTTGCAGAAAAAGAACTACCCGCAAGAAGACATTAACCACCTGTCTTACCTGCTA
TGTACCTATATCGATGGCATTTTTAACGGGCTGCAAACCCCAGACTCCTACAACCAAAGTCTGTTAGTGG
AGTTTCACCGTGATGCCTGGGGGGGTGAGGACTGCTTCGAACATCTGCGGGTCTATATGAACTCGCCGAA
ACAGTACCGGGAAGTTCTGGAATTCTATGATCTGATTATGTGCCTTGGTTTTGACGGTAAATACCAGATG
ATAGAGCATGGTGCGGTTCTGCTGATGGATTTACGCAGCCGTCTCCACACGCAACTCTACGGTCAGGACG
CCACACAATCTTTGGCTATCGCGCAAGCGGTCAAAGGTTCTCCGCGTCGCCAATATATCAAGGCGCTGAA
AATCTTCACCTATGGTTTCGCACTGTGCCTTTGTGCTTACGGCGTCACGGCGTGGTATCTGCACCAGCAA
TCCCAACAGATCCGCAGCAACATTCTGACGTGGGTACTGCCTGAACCGCGGAAAATCAACATCATGGAGA
CCTTGCCGAATCCGCTATCCAACATCCTGAATGAAGGGTGGCTGGAGGTCAGGAAAGATCCGCGTGGATG
GCTATTAATCTTCACCTCCGACGGCGCGTTCCGCACGGGTGAAGCGACCCTCTCGGAAGAGTTTATCAAC
AAGAAGAATATCGAACGTCTTGGGCTGGCATTAGCCCCATGGCCGGGAGATATCGAGGTTATTGGTCATA
CGGATAACAAACCGTTCCGTAGCACTTCCGGTAACAACAACCTCAAACTTTCCGCGGCCAGAGCATCGGT
GGTGGCAGATAAACTGCGGGAATCCACTCAAATCAACGAAACCCATCAGCGAGAAATAAGTGCCATCGGA
CGGGGGGAGAGCGATCCTTTAGCTGACAATGCAACGGAAGAAGGGCGCAAGCGTAACCGGCGTGTGGATA
TCCTATGGAAAATTGGTCAGCGCGATGCCGATAAGGCCATGAAGCAATTCCTGGAGAACCCAACACCAGA
AGTTCAAGGAACGAATACCCAACAATAG
 Primer design