SecReT6
Protein ID: 45443398
SecReT6 ID59
T6SS typei3
Gene symbol-
Locus tagYP_3666
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]4174562..4175935 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ8CKD7
KEGG IDypk:y3660, ypm:YP_3666
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-121, Aligned region: 25..452
Protein Sequence: 457 a.a.     [Download]
>gi|45443398|ref|NP_994937.1| hypothetical protein YP_3666 [Yersinia pestis biovar Microtus str. 91001]
MQRTHNMLPKQRVAWVEGMLMEPQHFQQQERYLEHLTEMRARSLSALAWGFHSLSINQGLLDQGKIALNQ
ASGVFPDGTPFHMAGDEPLPLPFDPGENCQGSVVCLSVLMDIPGNTYIDLKKSNQGSRFVALDAEVQDRN
HGVAAEGTPLIATLQLGQLQSKLTLRASVSDAESMLPVAYIKERTRDGRLILDDNFLPPMLDFRAIGWID
NAVTELLGLIVQRLESVYRPDVTLSVGGLSELLELLLLQTLSEYNLKISHVLMQKQVHPEQLFQLLLGLL
GRLSTIPGGEKPWSRQDLLYTHHEPHNGYFSLFAALRRALSLVIEAPAVALPFIERGDNIYLCQNDSQLR
LEKLIFTVSSKLPSETIRTYFPAQTKLGPVEKIVQLIDLQLPGARMIPMSSPPRYIPYYPNSVYFEVDHD
DPMYKEMMSGSAIALSIVGDFPELRFEVWGLRQGRLG
 
Nucleotide Sequence: 1374 bp     [Download]
>gi|45439865|ref|NC_005810.1|:c4175935-4174562 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
TTGCAAAGGACTCATAATATGCTGCCAAAACAACGTGTTGCTTGGGTGGAAGGGATGCTGATGGAACCCC
AGCATTTTCAACAACAGGAACGATATCTAGAACATTTAACTGAAATGCGGGCACGTAGCCTCAGCGCGCT
GGCATGGGGCTTCCATAGCCTAAGTATCAATCAAGGGCTGCTGGATCAGGGCAAGATCGCCCTCAATCAG
GCCAGTGGTGTTTTCCCTGACGGTACACCTTTTCATATGGCGGGTGATGAGCCATTACCGCTACCTTTTG
ATCCGGGGGAGAACTGCCAAGGCAGTGTCGTGTGCCTTTCGGTCCTGATGGATATACCCGGCAATACCTA
TATTGATCTGAAGAAGAGCAACCAAGGTAGCCGTTTCGTTGCGCTGGATGCTGAAGTTCAAGACAGAAAC
CATGGCGTCGCTGCTGAAGGAACGCCATTGATCGCCACCCTTCAACTGGGGCAATTGCAATCCAAGCTCA
CCTTACGTGCCAGCGTCAGTGATGCAGAATCGATGCTGCCCGTAGCCTATATCAAAGAGCGCACCCGCGA
TGGGCGTCTGATTCTGGATGATAACTTCCTGCCACCCATGTTGGATTTTCGCGCCATAGGGTGGATCGAT
AATGCGGTAACCGAATTGCTAGGGTTGATCGTTCAGCGACTGGAATCGGTTTACCGGCCAGATGTGACGC
TCTCAGTCGGTGGGTTATCGGAGTTACTGGAACTGCTATTACTGCAAACACTCAGTGAATATAACCTAAA
GATTTCACATGTGTTGATGCAAAAACAGGTACACCCTGAGCAGTTGTTCCAATTATTGCTTGGGTTGTTG
GGGCGTCTCAGTACTATCCCTGGCGGAGAAAAACCGTGGTCGAGGCAGGATCTGCTCTATACGCATCATG
AACCGCACAACGGGTATTTCTCGCTGTTTGCCGCCTTACGGCGCGCACTCTCACTGGTGATCGAAGCACC
GGCAGTGGCGCTACCGTTTATCGAACGTGGCGACAATATTTACCTGTGCCAGAACGATTCACAACTGCGT
CTGGAAAAACTGATCTTCACCGTCAGTTCCAAACTGCCTTCCGAGACCATTCGCACTTACTTCCCGGCGC
AAACCAAACTGGGGCCGGTGGAGAAAATTGTACAGTTGATCGACCTGCAATTGCCTGGCGCACGGATGAT
CCCGATGTCATCACCGCCAAGATATATTCCTTATTACCCGAATAGCGTCTATTTCGAAGTTGACCATGAT
GATCCTATGTATAAAGAAATGATGTCTGGTTCAGCTATCGCACTCAGCATCGTGGGTGATTTCCCTGAGT
TGCGTTTTGAAGTATGGGGCTTGCGACAAGGAAGGCTCGGATGA
 Primer design