SecReT6
Protein ID: 45443399
SecReT6 ID59
T6SS typei3
Gene symbol-
Locus tagYP_3667
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]4176019..4176510 [-]
Productlipoprotein
NoteTssJ
UniProt IDQ74Q45
KEGG IDype:YPO0512, ypm:YP_3667
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-17, Aligned region: 16..155
Protein Sequence: 163 a.a.     [Download]
>gi|45443399|ref|NP_994938.1| lipoprotein [Yersinia pestis biovar Microtus str. 91001]
MRSLFRVLPIFILTGCVLLSGCSWFSSSSEAALQKRRIDLQVVAAPLINPGPNGQAQPLKVCIIELNKEG
WSPPGLYQGTLCSGISVGGEVVSVTEYILAPTEVRQYSRDVPFEQERWWAIAAEFQEMSNGKSLLTLKSD
ARADFNRVVLVDGKALSLKASTK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|45439865|ref|NC_005810.1|:c4176510-4176019 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
ATGCGTAGCCTCTTTCGTGTGTTGCCTATTTTTATCCTGACAGGTTGCGTCCTGCTCAGCGGCTGTAGCT
GGTTTTCCTCATCCTCAGAAGCGGCGCTACAGAAACGGCGGATTGACTTGCAGGTTGTTGCGGCTCCTCT
CATCAATCCTGGGCCCAACGGTCAGGCACAGCCCTTGAAGGTATGCATTATTGAGCTGAATAAAGAGGGG
TGGTCACCCCCCGGTTTGTATCAGGGGACGCTCTGCAGTGGCATCAGTGTAGGAGGTGAAGTCGTCAGCG
TGACGGAATACATCCTTGCGCCGACAGAGGTGCGTCAATATTCCCGCGATGTTCCCTTTGAACAAGAGCG
CTGGTGGGCAATAGCGGCTGAGTTTCAGGAGATGAGTAACGGTAAAAGCCTATTAACGCTGAAATCTGAT
GCCCGTGCGGACTTCAACCGTGTGGTGCTCGTTGATGGTAAGGCCCTGTCATTAAAAGCGTCAACAAAGT
AG
 Primer design