SecReT6
Protein ID: 45443400
SecReT6 ID59
T6SS typei3
Gene symbol-
Locus tagYP_3668
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]4176503..4176868 [-]
Producthypothetical protein
NotePAAR
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF4150 [PF13665], Evalue: 1.70E-20, Aligned region: 18..107
PAAR_motif [PF05488], Evalue: 0.0028, Aligned region: 66..120
Protein Sequence: 121 a.a.     [Download]
>gi|45443400|ref|NP_994939.1| hypothetical protein YP_3668 [Yersinia pestis biovar Microtus str. 91001]
MTAANTRAGGISFIGSDPMIPISAPNTAPNANGIPNVSNYFCCGGNEQNLNTIRPATIDGGSVMGAASGT
HSAKMDPMQGSGKYFIQGSPATRLGDMSMTNNYNAPSTQIAPSQTKYFVNA
 
Nucleotide Sequence: 366 bp     [Download]
>gi|45439865|ref|NC_005810.1|:c4176868-4176503 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
ATGACAGCAGCCAATACTCGCGCAGGTGGGATCAGCTTTATCGGCAGTGACCCGATGATCCCGATATCTG
CTCCCAACACCGCGCCCAACGCCAATGGTATTCCTAATGTCAGCAACTATTTTTGCTGTGGGGGTAACGA
ACAGAATCTCAACACCATCCGTCCAGCCACGATAGACGGCGGATCTGTGATGGGGGCGGCCTCGGGGACA
CATTCGGCCAAGATGGACCCTATGCAGGGATCAGGAAAGTATTTCATTCAGGGAAGCCCAGCAACACGTT
TAGGAGATATGAGTATGACCAATAATTACAACGCGCCTTCGACGCAAATTGCGCCCAGCCAGACCAAGTA
TTTTGTCAATGCGTAG
 Primer design