SecReT6
Protein ID: 45443406
SecReT6 ID59
T6SS typei3
Gene symbol-
Locus tagYP_3674
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]4185903..4186925 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ8CKD2
KEGG IDypk:y3670, ypm:YP_3674
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.40E-66, Aligned region: 31..325
Protein Sequence: 340 a.a.     [Download]
>gi|45443406|ref|NP_994945.1| hypothetical protein YP_3674 [Yersinia pestis biovar Microtus str. 91001]
MMVKPSPNGGLSTMASLQTLKNTFLPGISASQDFFELLRRIERATPEQGRLGTQRDRSHLRLRIIQPADM
GFAPREVSDIRQTLNTHQHLAEITIFCRHFGLFAPYGPLPIHVTEHARNEALAKRNQAFEHFAGILSQRM
AILHYRSWAQMHVAVGHDRASANPFMNHVRQIAGLTPQQALNSHVDRVRRCFPGVYLPGRGSLRKLQEIL
SLYFSVPIRVEARKGLWIDDSRNIESQRMGRLGNTRIGSRFFDVQHSLVLSIGPVSDPQYLDFQRNSKRI
NTLVQICHDFVRHRMVLDVQLIIQTSPNMACRLGGGTLSRHSWLKPGSALSIQPIYRTVT
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|45439865|ref|NC_005810.1|:c4186925-4185903 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
TTGATGGTGAAACCTTCGCCAAATGGGGGCCTGTCAACTATGGCTAGCCTCCAGACGCTGAAAAACACGT
TTCTGCCGGGTATCTCGGCCAGTCAGGACTTTTTCGAGTTGCTGCGTCGCATTGAGCGTGCCACTCCAGA
GCAAGGCCGGCTTGGCACCCAACGTGATCGTAGCCATCTGCGGCTACGTATTATTCAGCCTGCCGATATG
GGATTTGCACCGCGTGAAGTGAGTGATATCAGGCAAACGCTGAACACTCATCAGCATCTGGCAGAGATCA
CCATTTTCTGCCGCCATTTTGGTTTATTTGCCCCGTATGGCCCGTTGCCAATACATGTTACCGAACATGC
TCGTAACGAAGCGTTGGCTAAACGTAATCAGGCCTTTGAACATTTTGCGGGCATTCTCAGCCAGCGAATG
GCGATCTTGCATTATCGCTCTTGGGCCCAAATGCACGTCGCCGTGGGGCATGATCGCGCGTCAGCCAATC
CCTTTATGAACCATGTGCGTCAAATCGCGGGCCTAACGCCGCAGCAAGCGCTGAATTCACATGTGGATCG
GGTACGGCGTTGCTTTCCGGGGGTGTATCTGCCGGGCAGAGGATCATTACGCAAATTACAGGAGATCCTG
AGCCTGTATTTCTCGGTTCCTATCCGTGTTGAAGCCCGTAAAGGATTGTGGATTGACGACTCGCGCAATA
TAGAAAGCCAACGTATGGGACGGTTGGGTAACACGCGTATTGGCAGCCGTTTCTTCGATGTGCAGCACAG
CCTGGTGTTATCTATTGGTCCGGTATCTGACCCCCAATATCTGGATTTTCAACGCAACAGCAAACGCATT
AACACTCTGGTGCAAATCTGCCATGACTTTGTCCGCCATCGGATGGTGCTGGACGTGCAATTAATCATAC
AGACCTCACCCAATATGGCTTGTCGTCTTGGCGGTGGAACGCTCAGTCGCCATAGCTGGTTAAAGCCAGG
CTCAGCCTTGAGTATACAGCCAATTTATAGAACGGTTACCTAG
 Primer design