SecReT6
Protein ID: 45443407
SecReT6 ID59
T6SS typei3
Gene symbol-
Locus tagYP_3675
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]4186879..4188723 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ7CG95
KEGG IDype:YPO0504, ypk:y3671, ypm:YP_3675
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-143, Aligned region: 6..609
Protein Sequence: 614 a.a.     [Download]
>gi|45443407|ref|NP_994946.1| hypothetical protein YP_3675 [Yersinia pestis biovar Microtus str. 91001]
MPNESFLALYNEELRYLREDGQRFAHMHPQVAQHLGLHADGVLDPFVERLLEGTAFLSSRIQQRLNNEHP
EFALQMLGRLAPLWYTPLPSIATIAMVPDLTSPQWHSRVVLPKGSRVTLSDSSLNNRLANFSTGRTLKIQ
PLVIENAECASTPPAYLPLSVASQLQAGQAHLRLRLTTQGVASLSELDFAPMNLTLAGGIIQSNQLITTL
LNNTLHIVLWANTDGKPLVKVLTKEHLRQGGLDEQEALLPVAISEMPGNRLLREYFAAPSRFFDLELHGL
NDFLQQGDGIHTFEVLFVLDQRPLHLIDRVTGNDFRLFATPIINLFKRRCSPVLINGEHTEYPVIVDPLN
PRLYEVHHVLGVNGLLSEGGSVQFSSLHGHARFDDDDKMAGYSIRRRRDFTDKNHQKNSPLPHDSLFIAL
SPGTSGIDIDHVKSLSIEAMVCERHLIPSQLQHPEFKLEIALPVGQIEMLRHPAKPQGVPNIDQAWRALQ
LIANNPLRYALPDVTDCSPLLKDWLSIFCQHEEASQHKRITSLTHASVAHNFERHTAPGPIAWSRGVEAT
LDFNSSHHSDKGAFLFARILHHALSEYCELGQTLRLHMQVDGETFAKWGPVNYG
 
Nucleotide Sequence: 1845 bp     [Download]
>gi|45439865|ref|NC_005810.1|:c4188723-4186879 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
ATGCCCAACGAAAGTTTTCTGGCTCTATACAACGAAGAGTTGCGTTATCTGCGTGAAGATGGGCAGCGCT
TCGCTCATATGCATCCGCAAGTCGCCCAACACCTTGGGTTACATGCTGATGGTGTGCTCGATCCTTTCGT
CGAACGGCTCCTTGAAGGCACCGCTTTCTTGAGTTCCCGTATCCAACAGCGTTTGAACAACGAGCATCCA
GAGTTTGCTTTGCAAATGCTTGGGCGTTTGGCCCCACTTTGGTATACACCCCTGCCGTCGATTGCCACCA
TTGCCATGGTTCCGGATCTTACGTCACCGCAATGGCACTCGCGCGTCGTATTGCCTAAAGGTAGCCGCGT
GACATTGAGTGACAGTTCGCTGAACAACCGGTTGGCGAATTTCTCTACTGGCCGCACGCTGAAAATACAG
CCATTGGTCATTGAAAATGCCGAGTGTGCCAGCACGCCACCGGCGTATTTACCGCTCTCTGTGGCTTCAC
AATTACAAGCTGGTCAGGCCCATCTGCGCTTGCGTCTGACCACTCAAGGTGTCGCGTCTTTATCTGAGCT
GGATTTCGCCCCGATGAACCTGACGCTAGCGGGGGGAATAATTCAGTCAAATCAGTTAATCACGACACTG
TTGAATAACACCTTACATATTGTTTTGTGGGCCAACACGGATGGGAAACCGCTGGTCAAAGTTCTTACCA
AAGAACATCTTCGCCAGGGAGGGCTGGATGAACAAGAGGCGCTTTTACCTGTTGCGATCAGCGAAATGCC
TGGAAACCGTTTGCTACGAGAATATTTTGCTGCTCCTTCGCGTTTTTTCGATCTGGAACTGCATGGCCTC
AACGACTTCCTGCAACAAGGGGACGGCATTCATACCTTTGAGGTGCTGTTTGTACTGGATCAGCGCCCCC
TACATTTGATTGATAGGGTCACTGGCAATGACTTCCGACTCTTCGCCACACCTATTATTAACCTGTTCAA
ACGCCGTTGTAGCCCGGTGCTGATTAATGGTGAACACACCGAATATCCCGTCATTGTTGACCCCCTGAAC
CCCCGCTTGTACGAAGTCCATCATGTACTCGGGGTCAACGGTTTGTTGAGCGAAGGGGGGAGCGTGCAGT
TTTCTTCCCTTCATGGTCATGCCCGTTTTGATGATGACGATAAAATGGCGGGTTACAGCATTCGCCGTCG
CCGCGACTTCACGGATAAAAATCATCAGAAAAATTCACCTTTACCTCATGACAGCTTATTCATTGCCCTT
TCACCGGGGACCAGCGGGATAGATATTGATCACGTCAAGTCGCTGTCGATTGAAGCCATGGTGTGCGAAC
GCCACTTAATTCCCAGCCAATTACAGCATCCGGAATTCAAGCTGGAAATTGCCCTGCCAGTGGGGCAGAT
CGAAATGCTGCGTCACCCGGCAAAACCACAGGGTGTGCCGAATATTGATCAAGCCTGGCGGGCGTTACAA
CTGATTGCCAACAATCCGCTGCGTTATGCGCTGCCGGATGTCACCGATTGTTCGCCGCTGCTAAAAGATT
GGCTGTCGATATTTTGTCAGCATGAAGAGGCGAGCCAGCATAAGAGGATCACTAGCCTGACTCACGCCAG
TGTGGCGCATAATTTTGAACGTCATACCGCTCCGGGGCCGATCGCCTGGAGCCGGGGGGTTGAAGCCACA
CTGGATTTCAACAGCAGCCACCACAGTGATAAAGGTGCATTCCTCTTTGCGCGGATCCTGCATCACGCGC
TGTCAGAATATTGTGAATTAGGGCAGACCCTGAGGTTACACATGCAGGTTGATGGTGAAACCTTCGCCAA
ATGGGGGCCTGTCAACTATGGCTAG
 Primer design