SecReT6
Protein ID: 470153463
SecReT6 ID649
T6SS typei1
Gene symbol-
Locus tagW5S_0975
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]1079991..1083488 [+]
ProductType VI secretion protein IcmF
NoteTssM
UniProt IDK4FG98
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.30E-92, Aligned region: 505..819
ImcF-related_N [PF14331], Evalue: 5.20E-70, Aligned region: 200..458
ImcF-related_N [PF14331], Evalue: 5.20E-70, Aligned region: 888..928
DUF1215 [PF06744], Evalue: 4.20E-31, Aligned region: 905..1023
Protein Sequence: 1165 a.a.     [Download]
>gi|470153463|ref|YP_006281965.1| Type VI secretion protein IcmF [Pectobacterium sp. SCC3193]
MFKTIITFLRKQLPKLKPSWLLLGALLWVVVLVLAWWLGPRLTVGESRPLQGIWGRVVFTLVWLWLAFSY
SAWLVWRRVQLMRSERHEQQVTEQDPLQVYVDGQQTFLDRWLDAFQTQLGKKALYAMPWYLTIGLAGSGK
SSLIHRANPANKMNPKLDAELRDVAAGQQVSSWVGESAVIWDPSGQLLAQPELEGDALGQRHARLWQHLL
QWLSENRRRQPLNGLVLTLDISWLAQAGVADRKAYAQVMRARLQEISVSINTRLPVYIALTRLDMLSGFD
KVYRQLNRDARQAVLGVTFTPQASNSKGWLEELERFWDEWVTHLNDNLPDMLLTQSDRSVRNSLFSFVRQ
LAGVKDYVMEVLTETLAIGEDRAFLIRGVYVSSVYQQGVPFDAFAQSASRRYQLPEPINPALRGESNTFF
VQRLFPDVIFPEASLAGENRLHSLYRRRRLSIGVGCMLLAGLVLVGSWHHFYRVNEEAGRNVLTKAQAFI
GTNELEGQPGYGYQQLPRLNLIRDATLSFGNYHERTPLLADLGLYQGDKIGPYVEGTYLQMLNQRFLPAV
MQGLLEDLNQAPANSEQKLTILRVMRMLDDASGRNKALVEQFMAQRWQKAFPAQGQVQEELMQHLDYALD
HTNWHQSREQKDAVAISTFAPFNGPITLAQQELSKLPMYQRVYQSLVMKATQVLPPDLAIRDEVGPTFDP
VFSLRNDKAGSVPRLLTYPGFSDYYLKQDKALLELTALDAWVLGQRERAQFSEADRREILRQVNDRYITD
YINQWQKVLANIDVQALDTPEQALDILTDITGNDQPFQRVLTTVSDNTRIRKLADDDNDTAQNINTRTGR
PFMTINAALSGRGEQGPLVQEVNQKLTDLYHYLDQIVNATDPGQAALKAMQARQGNKFADPVFALQQYAR
SLPAPLDRWVGQLAGESASLVTGLAMSSLNQEWLDKVVTPFNEKLANRYPFDPSSDKDVPLSEMEMFFMT
GGTLDSFYQTNLKAMMESGMLEEGMASPMQAELMKQLERANRIRQTLFNAQGSLEVHFVLEPLELTANKR
RSVLNLDGQLLEYSHGRRQKTPLVWPNSMRDGAESKLTLVPDDRERSPRSLSFNGPWAMFRLINSDQLTK
VNENTFDVRFSLENGAMTYRVYTDASHNPFAGGLFSQFTLSDSLY
 
Nucleotide Sequence: 3498 bp     [Download]
>gi|470152509|ref|NC_017845.1|:1079991-1083488 Pectobacterium sp. SCC3193, complete genome
ATGTTTAAAACAATTATAACCTTTCTACGCAAGCAGTTGCCTAAACTGAAACCCTCCTGGCTGCTTTTGG
GGGCGCTACTGTGGGTCGTGGTGTTGGTTCTGGCCTGGTGGCTGGGGCCGCGTTTGACGGTAGGCGAGTC
GCGTCCGTTACAGGGGATCTGGGGCCGCGTGGTGTTCACGCTGGTCTGGCTGTGGCTGGCGTTCTCCTAT
AGTGCCTGGCTGGTCTGGCGGCGTGTGCAACTGATGCGGTCAGAGCGTCATGAGCAACAGGTGACCGAGC
AGGATCCCCTACAGGTGTATGTCGACGGCCAGCAGACGTTTCTCGATCGCTGGCTGGACGCGTTTCAGAC
CCAGTTGGGTAAAAAAGCGCTGTATGCGATGCCGTGGTATCTGACGATTGGTTTGGCTGGCAGTGGTAAA
AGTAGCCTGATCCACCGTGCCAACCCGGCAAATAAAATGAATCCGAAGCTGGATGCAGAGCTGCGGGATG
TGGCAGCAGGCCAGCAGGTGAGCAGTTGGGTCGGAGAATCTGCCGTCATCTGGGATCCTAGCGGGCAGCT
ACTGGCACAGCCTGAATTGGAAGGCGATGCGCTCGGGCAGCGTCATGCTCGGCTATGGCAGCACCTGCTA
CAGTGGCTCAGTGAGAATCGCCGCCGCCAGCCGCTTAACGGTCTGGTTCTTACGCTGGATATCTCCTGGC
TGGCACAGGCTGGTGTCGCAGATCGCAAAGCCTACGCGCAAGTCATGCGTGCCCGTTTGCAGGAAATTTC
GGTCAGCATCAATACGCGTTTACCGGTGTATATCGCACTGACTCGGCTGGATATGCTGAGCGGCTTCGAC
AAGGTCTATCGCCAGTTGAACCGCGACGCGCGTCAGGCGGTATTAGGGGTGACGTTTACCCCACAGGCGA
GCAACAGCAAAGGCTGGTTAGAAGAGCTGGAGCGTTTTTGGGATGAGTGGGTCACGCACCTGAATGACAA
CCTGCCAGACATGCTGTTGACCCAATCGGACAGAAGCGTGCGCAATTCGCTGTTCTCGTTTGTTCGCCAG
TTGGCCGGGGTGAAAGACTATGTGATGGAAGTGCTGACGGAAACGTTAGCAATAGGTGAAGATCGCGCGT
TCCTGATCCGTGGCGTCTACGTCAGCTCTGTTTATCAACAAGGGGTGCCGTTTGATGCTTTTGCACAGTC
GGCCTCCCGACGTTATCAACTGCCAGAGCCGATTAACCCCGCGCTGCGCGGTGAATCGAATACGTTTTTT
GTCCAGCGTCTCTTCCCAGACGTCATTTTCCCTGAAGCCAGCTTGGCCGGAGAAAACCGACTGCATAGCC
TCTATCGTCGGCGTCGGTTGAGTATTGGTGTGGGCTGCATGCTGCTCGCCGGTTTGGTGCTGGTGGGCAG
TTGGCACCATTTCTATCGGGTCAATGAAGAAGCCGGGCGTAACGTACTGACGAAAGCGCAGGCGTTTATC
GGCACTAATGAACTGGAAGGCCAACCGGGCTACGGCTATCAGCAGTTGCCGCGTCTGAATTTGATTCGTG
ATGCGACATTATCTTTTGGTAACTATCACGAACGCACGCCGCTGCTGGCCGATCTGGGTCTGTATCAGGG
CGATAAGATCGGGCCTTATGTCGAGGGCACCTATCTGCAAATGCTGAATCAGCGCTTTTTACCGGCGGTG
ATGCAGGGGTTGCTGGAGGATTTGAATCAGGCGCCTGCCAATAGCGAGCAAAAACTGACCATTCTGCGTG
TAATGCGCATGCTGGACGATGCTTCTGGGCGCAATAAAGCGCTGGTCGAACAGTTTATGGCGCAGCGCTG
GCAAAAGGCATTTCCTGCTCAAGGTCAGGTGCAGGAAGAACTGATGCAACATCTGGATTACGCCCTCGAT
CATACCAACTGGCATCAGTCCCGTGAGCAAAAAGATGCGGTAGCGATTAGCACTTTTGCACCGTTTAATG
GGCCGATTACGCTGGCTCAGCAGGAACTAAGCAAACTGCCGATGTATCAGCGCGTTTATCAGAGTCTGGT
CATGAAGGCGACTCAAGTGCTGCCGCCGGATTTAGCGATCCGTGATGAAGTCGGACCGACGTTTGATCCG
GTGTTTTCGCTGCGTAACGACAAAGCGGGGAGTGTGCCACGACTGCTAACCTATCCCGGCTTCAGTGATT
ATTATCTCAAGCAGGACAAAGCGCTGCTAGAGCTGACGGCATTGGATGCCTGGGTTCTGGGACAGCGTGA
ACGTGCACAGTTCAGCGAGGCCGATCGGCGGGAAATTCTGCGTCAGGTGAATGACCGCTACATTACGGAT
TACATCAACCAGTGGCAGAAAGTGTTAGCGAACATTGATGTGCAGGCGCTCGATACGCCAGAACAGGCGC
TAGATATCCTCACGGACATTACCGGTAACGATCAGCCCTTCCAGCGCGTGCTGACGACGGTCAGTGATAA
CACCCGCATCCGTAAGCTGGCCGATGATGATAACGACACGGCGCAGAACATCAATACGCGTACTGGTCGT
CCGTTTATGACCATCAATGCGGCGCTGAGTGGACGCGGTGAGCAGGGGCCGCTGGTGCAAGAGGTCAATC
AGAAACTGACCGATCTCTATCACTATCTCGACCAGATTGTTAACGCGACCGACCCGGGACAGGCGGCATT
GAAGGCGATGCAGGCACGGCAGGGAAATAAATTTGCCGATCCGGTATTTGCCTTACAGCAATATGCTCGC
AGCCTCCCTGCGCCGTTGGACCGCTGGGTAGGACAATTAGCCGGAGAGAGCGCCAGTCTGGTGACTGGGC
TCGCGATGTCATCGCTGAATCAGGAATGGCTGGATAAAGTCGTGACGCCATTCAACGAGAAGCTGGCGAA
TCGTTACCCCTTCGATCCGTCATCCGACAAAGATGTGCCGCTATCGGAAATGGAAATGTTCTTCATGACG
GGCGGGACGCTGGACAGCTTCTATCAAACCAACCTCAAAGCGATGATGGAAAGCGGCATGCTGGAAGAAG
GCATGGCGTCGCCTATGCAGGCCGAGCTGATGAAACAGCTTGAACGCGCTAATCGTATCCGTCAGACCCT
GTTTAATGCGCAGGGCAGCCTGGAAGTGCATTTCGTTCTGGAACCGCTGGAATTAACGGCGAACAAGCGC
CGCAGCGTGCTGAATCTGGATGGACAGCTACTGGAATACAGCCACGGCCGTCGCCAGAAAACGCCGCTGG
TGTGGCCAAACAGTATGCGCGACGGGGCTGAAAGCAAGTTAACACTGGTGCCGGACGATCGTGAGCGCTC
GCCGCGCAGCCTGAGCTTTAACGGGCCGTGGGCCATGTTCCGGTTAATCAATAGCGATCAACTGACGAAG
GTTAATGAGAACACCTTTGACGTGCGTTTCTCGCTGGAGAATGGGGCGATGACGTATCGCGTTTATACCG
ATGCCAGCCATAACCCGTTTGCTGGTGGTCTGTTCAGCCAATTCACGTTGTCTGACTCGCTTTATTAA
 Primer design