SecReT6
Protein ID: 470154895
SecReT6 ID650
T6SS typei3
Gene symbol-
Locus tagW5S_2437
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]2622182..2625778 [-]
ProductType VI secretion protein IcmF
NoteTssM
UniProt IDK4FVB9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.40E-100, Aligned region: 197..475
ImcF-related_N [PF14331], Evalue: 2.40E-100, Aligned region: 637..661
IcmF-related [PF06761], Evalue: 1.70E-80, Aligned region: 524..819
DUF1215 [PF06744], Evalue: 1.10E-30, Aligned region: 940..1065
AAA_16 [PF13191], Evalue: 0.003, Aligned region: 132..260
AAA_16 [PF13191], Evalue: 0.003, Aligned region: 811..906
Protein Sequence: 1198 a.a.     [Download]
>gi|470154895|ref|YP_006283397.1| Type VI secretion protein IcmF [Pectobacterium sp. SCC3193]
MLTSRLAWGFVGITALAFIIWVIGPVFSIADSRPLAPEHNRIISIALLYLVWGLSQAIPRLYNFWLNRKL
MSSLETGKTDAPERLTNEEQALASRFSEATGILKKAHFQRNSSKGAPFWAQRFSHQYLYQLPWCMIIGAP
GAGKTTALVNSGLQFPLADKFGKAALRGIGGTRNCDWWFTNEAVLLDTAGRYATQESQQERDASEWHHFL
DLLRKYRGRQPINGVIVTLSVSDLLTQSPEAMRNQAIALRQRLMELHDRLGIRFPVYVLVTKTDLLKGFR
SYFGSLDKAQREQIWGFTFPWAQASTADFELNSQFQKEYSLLQQRLDAGMADTLLAERDGQSRAEVYLFP
QEFAALRPMLADALDTLFARSDFETQFAPRGIYFASGTQEGLPFDRVMGELNRALHLPSQREGGSRRWDQ
VDKNAPIPPNKGQSFFLKDVLENVIFQESGLAGSNRWWELRNRAGLWSGYLALLVLILIAGGLWVTSYSQ
NKSYLQEIAGKTPQVEQLGQQLQREGHGDLFALVPYLNTLLQLPKSADFSLDAPPQTRRMGLYRGTEIND
ATQALYGKALKQLLLPQVAQNITRWLRNDNGSDADYSYEALKAYQMLYQPKHYDGKFLQAWLMLNISREL
PQNVTQQEVKQLAWHLQQLLETHIQSSPYAKDDALIKRGQVLINQMPLSQRVYGRLKRLLQRDGSLKSVT
LSALGGPQSELVFSRKSGKSVNDGVSGLFTPDGYWQRVDKQIAPVTQALYQDDIWVLGGITPQENSQQTD
LAVRQWYVQDYIRQWEQFLSDIQLNTSADLPQRINTARLLSGNHSPLRQWVINLGKLLTLTRESADEKTA
QAQSSSGNNATRTLEALFNSMDTNATQGQGATQQSPEQAVAVHFAPIIELAQPLQPGGNVLAVDDFLHQI
DDLYRYLTAVQDAANSGMPPPSNDAISRLQASAGRLPGSLQNMVSSMAVGASSDAQRRDMDNVRKRITME
VGSFCRQAIAGRYPLVRNARSEVTPDDLARMFAPGSGLMDSFFRDNLASKVDTTHAAWRFTPGIDGKTLP
GGEALLRPFQQAQSIRDAFFANGATTSSFRITLRTVKMDNAILNLTLDVDGQILRYSHGPQAVQMVNWPG
SGGTSQVRMQLGLTNGTTSTLVTSGPWALNRFFDRARLTSTGGLTREARFDVDGHQVTLSFTPGSIRNPF
QLPSFGCP
 
Nucleotide Sequence: 3597 bp     [Download]
>gi|470152509|ref|NC_017845.1|:c2625778-2622182 Pectobacterium sp. SCC3193, complete genome
GTGCTGACCAGCCGCCTCGCTTGGGGCTTTGTTGGTATTACTGCGCTCGCCTTTATCATCTGGGTGATTG
GCCCGGTGTTTTCCATTGCAGATTCACGCCCGCTTGCACCAGAGCATAATCGCATCATCAGTATCGCGCT
GCTCTATCTGGTGTGGGGACTGAGTCAGGCGATCCCGCGCCTGTACAACTTCTGGCTTAACCGCAAGTTG
ATGTCGAGTCTGGAAACTGGCAAAACCGATGCACCGGAACGCCTGACCAACGAAGAGCAGGCCTTGGCGA
GCCGTTTTTCTGAAGCGACGGGTATCCTGAAAAAAGCACACTTCCAGCGCAATAGCAGTAAAGGCGCCCC
GTTCTGGGCGCAGCGCTTCAGCCATCAATATCTCTATCAGTTACCGTGGTGCATGATTATCGGTGCGCCG
GGGGCGGGTAAAACCACAGCGCTGGTTAACTCGGGTCTGCAATTCCCGTTAGCGGATAAATTTGGTAAAG
CGGCGCTGCGCGGTATTGGTGGTACGCGTAACTGCGACTGGTGGTTCACCAACGAAGCGGTGCTGCTGGA
TACCGCCGGACGTTACGCCACCCAAGAGAGTCAGCAGGAGCGCGATGCCAGCGAATGGCATCACTTCCTC
GACCTGTTGCGTAAGTATCGCGGTCGCCAGCCGATTAATGGCGTGATCGTCACGCTGAGCGTGTCGGATC
TGCTGACACAATCACCGGAAGCGATGCGTAATCAAGCCATCGCGCTACGCCAGCGCCTGATGGAGTTGCA
TGACCGCCTCGGCATTCGCTTCCCGGTGTATGTGCTGGTGACCAAAACCGACCTGCTCAAAGGTTTCCGC
AGCTACTTCGGTTCGCTGGATAAAGCGCAACGCGAACAGATCTGGGGGTTCACCTTCCCGTGGGCACAGG
CCTCCACCGCTGACTTCGAACTCAACAGCCAGTTCCAAAAGGAATATTCGCTGTTACAACAGCGTCTTGA
TGCTGGCATGGCCGATACGTTGCTGGCAGAGAGAGATGGACAGTCGCGCGCAGAGGTCTATCTGTTCCCG
CAGGAGTTTGCCGCGTTGCGCCCAATGCTAGCGGATGCGCTTGACACGTTGTTCGCGCGTTCGGATTTTG
AAACCCAGTTCGCACCACGTGGCATCTATTTTGCCAGCGGTACACAGGAAGGTCTGCCGTTTGACCGCGT
GATGGGGGAGTTGAACCGTGCTCTGCATCTGCCGAGCCAGCGAGAAGGTGGATCCAGACGCTGGGATCAG
GTGGATAAAAACGCGCCGATCCCACCGAATAAAGGGCAAAGCTTCTTCCTGAAAGATGTACTGGAAAACG
TTATCTTTCAGGAATCGGGGCTTGCGGGTAGCAACCGTTGGTGGGAACTGCGTAACCGTGCTGGTTTGTG
GTCTGGCTATCTGGCATTGCTGGTGCTGATACTGATTGCCGGGGGGCTGTGGGTTACCAGCTACAGTCAA
AATAAATCTTACCTGCAGGAAATCGCGGGCAAAACGCCGCAGGTTGAGCAACTCGGCCAGCAACTACAGC
GTGAAGGCCACGGTGACTTGTTCGCTCTGGTGCCGTATCTCAATACCCTGCTGCAGTTGCCTAAAAGCGC
TGATTTCTCACTGGACGCGCCGCCGCAGACGCGCCGTATGGGGCTCTATCGCGGGACTGAAATCAACGAT
GCCACTCAGGCGTTGTATGGCAAAGCGCTAAAACAGTTGCTGTTGCCGCAGGTGGCGCAAAATATTACGC
GCTGGTTGCGCAACGACAACGGCAGCGATGCCGACTACAGCTACGAAGCGCTAAAGGCGTATCAGATGCT
GTATCAGCCGAAGCACTACGACGGTAAATTCCTGCAGGCATGGCTGATGCTAAATATCTCGCGCGAACTG
CCGCAGAACGTCACTCAGCAGGAAGTTAAACAACTGGCGTGGCATCTACAACAACTGCTGGAGACGCACA
TCCAGTCTTCGCCATACGCGAAGGATGATGCGTTGATAAAGCGCGGGCAGGTGCTGATTAACCAAATGCC
GCTGTCACAACGCGTCTATGGGCGTCTGAAGCGCCTGCTGCAACGCGATGGCAGCCTGAAATCGGTGACG
CTCTCGGCGCTGGGCGGGCCACAGAGTGAACTGGTGTTCTCACGTAAAAGTGGTAAGTCGGTTAATGATG
GTGTGTCAGGCCTGTTTACACCGGATGGTTACTGGCAGCGCGTTGATAAGCAAATTGCGCCAGTGACGCA
GGCACTGTATCAGGATGATATCTGGGTGTTGGGCGGCATCACGCCGCAGGAAAACAGCCAACAAACCGAT
CTCGCAGTACGCCAATGGTATGTACAGGATTACATTCGTCAGTGGGAACAGTTCCTTAGCGATATCCAAC
TCAACACTAGTGCTGATTTACCGCAGCGCATCAACACCGCGCGTTTGCTGTCCGGCAACCATTCACCGTT
ACGCCAATGGGTGATCAATCTGGGAAAATTGCTGACGCTGACGCGCGAGTCGGCGGATGAAAAAACGGCA
CAGGCGCAGTCGTCATCCGGCAACAACGCGACGCGCACGCTGGAAGCGCTGTTCAACTCGATGGATACTA
ATGCAACGCAGGGGCAGGGGGCGACGCAGCAGTCACCGGAGCAGGCCGTTGCCGTGCATTTCGCCCCGAT
TATCGAGTTGGCGCAGCCGTTACAGCCGGGCGGTAACGTGCTGGCGGTGGACGATTTTCTACATCAGATT
GACGATCTCTATCGTTATCTCACCGCGGTGCAGGATGCGGCCAACAGCGGCATGCCGCCGCCATCGAACG
ATGCCATCAGCCGCCTGCAGGCCAGTGCTGGCCGTCTGCCGGGTTCGCTGCAGAATATGGTCTCCAGTAT
GGCGGTTGGTGCCAGCAGCGATGCACAACGCCGTGACATGGATAACGTGCGCAAGCGCATCACCATGGAA
GTTGGCAGCTTCTGTCGTCAGGCGATCGCCGGTCGTTATCCACTGGTACGCAACGCACGCAGTGAAGTGA
CGCCAGACGATCTGGCGCGCATGTTTGCACCGGGCAGCGGCCTGATGGATAGCTTCTTCCGTGACAATCT
GGCCAGTAAAGTGGACACCACTCACGCCGCGTGGCGCTTTACGCCGGGTATCGACGGTAAAACGCTGCCG
GGGGGCGAAGCACTGCTGCGTCCGTTCCAGCAGGCGCAGTCGATTCGTGATGCCTTCTTTGCCAACGGAG
CCACCACATCATCGTTCCGCATCACGCTGCGCACGGTGAAGATGGATAACGCGATCCTCAACCTGACGCT
GGATGTTGACGGTCAGATTCTGCGTTACAGCCACGGCCCGCAGGCGGTGCAGATGGTGAACTGGCCCGGT
TCAGGCGGCACCAGCCAGGTGCGCATGCAGCTCGGCCTGACTAATGGCACTACCTCGACACTGGTCACCA
GCGGCCCGTGGGCGCTTAATCGCTTCTTCGATCGCGCCCGGCTGACCTCAACCGGCGGTTTGACCCGCGA
AGCCCGTTTCGACGTCGATGGTCATCAGGTCACGCTATCGTTCACGCCTGGCAGTATTCGCAACCCATTC
CAGCTTCCCAGCTTTGGCTGCCCCTGA
 Primer design