SecReT6
Protein ID: 470170148
SecReT6 ID736
T6SS typei4b
Gene symbol-
Locus tagAZKH_1745
StrainAzoarcus sp. KH32C
Repliconchromosome [GenBank: NC_020516] [Browse all T6SS(s) in this replicon]
Location [Strand]1952470..1953549 [+]
Producthypothetical protein
NoteTssA
UniProt IDH0PSB9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.30E-25, Aligned region: 53..113
Protein Sequence: 359 a.a.     [Download]
>gi|470170148|ref|YP_007551034.1| hypothetical protein AZKH_1745 [Azoarcus sp. KH32C]
MNLDELLRPLDGEAPCGSDMMFSVEFDQINEARRFDDPSLAQGEWIAEHKEADWARVVRLCEDLLYGRTK
DVRVAVWMVEALAKTRGLAGMAEGFRVLAGLCEAYWQHLHPQAEGDDMEPRIGNLEWLANRATRLVRGFL
LTCSPKGNYSTIDFESARALAQSVERNPGQSDELVLGARVTLVQFEAARRETASQHFVDGVRDAELASAQ
VRLLQMVLDRFLGRESPSFAAVLDVLDDFRLRMKRYAGEAGATDAPAEVAPAPVAGRASAPTSAVSGVAT
PAVAGIWSRAQAIRQLQEIAAFFRQTEPHSPVAYLADKAARWGSMSLHEWLRAVVKDDGALLRVEELLGV
DPGVGESGH
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|470168442|ref|NC_020516.1|:1952470-1953549 Azoarcus sp. KH32C DNA, complete genome
ATGAATCTGGATGAGCTGCTTCGCCCGCTGGACGGCGAAGCCCCGTGCGGCAGCGACATGATGTTCTCCG
TCGAATTCGACCAGATCAACGAGGCGCGCCGGTTCGACGATCCCTCGCTCGCCCAGGGCGAGTGGATCGC
CGAGCACAAGGAAGCGGACTGGGCGCGCGTGGTCCGGCTTTGCGAAGACCTGCTCTACGGCCGGACGAAG
GATGTGCGGGTCGCCGTTTGGATGGTCGAGGCGCTTGCCAAGACGCGGGGCCTTGCCGGAATGGCGGAGG
GTTTCCGCGTGCTCGCGGGCCTGTGCGAAGCCTACTGGCAGCACCTGCATCCGCAGGCGGAAGGCGACGA
CATGGAGCCGCGCATCGGTAACCTCGAGTGGCTCGCCAACCGGGCCACCCGCCTCGTGCGCGGGTTCCTG
CTGACTTGCTCGCCGAAAGGAAATTATTCGACCATCGATTTCGAATCGGCACGTGCCCTGGCCCAGAGCG
TCGAGCGCAATCCCGGGCAATCCGACGAACTTGTCCTGGGAGCGAGGGTAACGCTTGTTCAGTTCGAGGC
GGCACGCCGCGAAACGGCGTCGCAGCATTTTGTCGACGGCGTGCGCGATGCCGAACTCGCGAGCGCACAG
GTGCGCCTATTGCAGATGGTGCTCGATCGTTTCCTCGGCCGCGAATCGCCTTCCTTCGCTGCCGTGCTTG
ATGTGCTGGACGACTTCCGCCTGCGCATGAAGCGATACGCAGGGGAGGCCGGTGCGACCGATGCGCCTGC
CGAAGTTGCGCCCGCCCCGGTTGCCGGGCGCGCGAGCGCCCCGACGTCCGCCGTCAGCGGTGTCGCGACG
CCTGCTGTCGCAGGAATCTGGTCGCGAGCGCAGGCCATTCGGCAACTGCAGGAGATCGCAGCGTTCTTCC
GGCAGACCGAGCCGCATAGCCCGGTCGCCTACCTCGCAGACAAGGCCGCACGATGGGGCAGCATGTCGCT
GCACGAATGGCTGCGTGCGGTGGTCAAGGACGACGGCGCATTGCTCCGCGTCGAGGAACTGCTCGGCGTG
GACCCCGGCGTGGGCGAATCGGGTCACTGA
 Primer design