SecReT6
Protein ID: 470170149
SecReT6 ID736
T6SS typei4b
Gene symbol-
Locus tagAZKH_1746
StrainAzoarcus sp. KH32C
Repliconchromosome [GenBank: NC_020516] [Browse all T6SS(s) in this replicon]
Location [Strand]1953613..1954395 [-]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDH0PSC0, H0PSC0
KEGG IDaza:AZKH_1746
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.70E-20, Aligned region: 87..143
OmpA [PF00691], Evalue: 1.70E-20, Aligned region: 158..252
BON [PF04972], Evalue: 8.50E-07, Aligned region: 31..69
BON [PF04972], Evalue: 8.50E-07, Aligned region: 98..139
Protein Sequence: 260 a.a.     [Download]
>gi|470170149|ref|YP_007551035.1| OmpA/MotB domain-containing protein [Azoarcus sp. KH32C]
MTMPISMRCLVAAAVALNVFSAHALAEPVPGGQVVVSGAVPDEASRAAILARMRELYGASAVVDRMEVTN
VVAPPNWGSYMGKLLQSDLKQVHQGELQVTGTQVTLKGRVANDGLRQQVAANAANALNPTYTVTNALVVG
NGGQSLLDKTLSNRVVEFELGAATLTPVGTAILDEMLEAIRQLNNPKLQVIGHTDSTGDRGANVALSLAR
ATTVRNYLIAKGVSAASLTAVGAGPDRPANSNDTVEGRAKNRRIEFSLMN
 
Nucleotide Sequence: 783 bp     [Download]
>gi|470168442|ref|NC_020516.1|:c1954395-1953613 Azoarcus sp. KH32C DNA, complete genome
ATGACCATGCCAATTTCGATGCGCTGCCTCGTCGCCGCCGCCGTCGCCTTGAACGTTTTTTCCGCCCACG
CCCTTGCCGAGCCTGTCCCCGGCGGACAGGTCGTCGTTTCCGGGGCCGTTCCGGATGAGGCTTCGCGCGC
AGCAATACTCGCTCGAATGCGCGAACTCTATGGCGCTTCCGCGGTGGTGGATCGCATGGAAGTGACCAAC
GTCGTCGCGCCTCCGAACTGGGGCAGCTACATGGGAAAACTGCTTCAGTCGGACCTGAAGCAGGTGCATC
AGGGAGAATTGCAGGTCACGGGAACGCAGGTGACGCTGAAGGGGCGTGTCGCCAACGACGGACTGCGCCA
GCAGGTCGCGGCCAATGCCGCCAACGCCCTCAATCCGACTTACACCGTGACCAATGCACTGGTCGTCGGC
AACGGAGGGCAATCGCTCCTGGACAAGACGTTGTCGAACCGCGTGGTGGAATTCGAGCTCGGCGCGGCAA
CGCTGACTCCGGTGGGGACGGCGATCCTCGACGAGATGCTGGAGGCGATCCGGCAACTCAACAATCCGAA
GCTGCAAGTCATCGGACATACCGACAGCACGGGGGATCGGGGGGCCAATGTTGCACTGAGCCTCGCCAGG
GCCACGACAGTCCGAAACTACCTCATCGCCAAGGGGGTTTCGGCGGCGAGCTTGACGGCGGTCGGCGCCG
GCCCGGATCGGCCGGCGAACTCCAACGACACCGTCGAAGGGCGGGCGAAGAATCGCCGGATCGAGTTCAG
TTTGATGAATTGA
 Primer design