SecReT6
Protein ID: 470170151
SecReT6 ID736
T6SS typei4b
Gene symbol-
Locus tagAZKH_1748
StrainAzoarcus sp. KH32C
Repliconchromosome [GenBank: NC_020516] [Browse all T6SS(s) in this replicon]
Location [Strand]1955375..1959136 [-]
Producthypothetical protein
NoteTssM
UniProt IDH0PSC2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.40E-73, Aligned region: 79..107
ImcF-related_N [PF14331], Evalue: 1.40E-73, Aligned region: 186..445
IcmF-related [PF06761], Evalue: 5.80E-49, Aligned region: 56..101
IcmF-related [PF06761], Evalue: 5.80E-49, Aligned region: 490..830
DUF1215 [PF06744], Evalue: 7.10E-29, Aligned region: 542..568
DUF1215 [PF06744], Evalue: 7.10E-29, Aligned region: 964..1079
Protein Sequence: 1253 a.a.     [Download]
>gi|470170151|ref|YP_007551037.1| hypothetical protein AZKH_1748 [Azoarcus sp. KH32C]
MFSIRSFLTDSRFLSFVGIGAAVAFFFLGAKTLKVALFWAALASGLVVLAWLAVWAFQRWRASKASDAIG
RMLDEQGVAAASAKHAATEADIATLRARLQEAIRTIRTSKLGQTAGSAALYELPWYITIGNPAAGKSSAI
INSGLKFPFDDGGAPNVRGIGGTRNCDWFFTTGGILLDTAGRYSVYEDDRDEWLGFLDLLRKHRPRAPIN
GIIVTVSIGELIGNPPAFAIGLAKNLRQRIQELTERLRVFAPVYVMFSKADLIPGFHEFFQDVDWNERDR
VWGATFPYEAQPRNDLVAQFDARFDELYEGLRALSVALLSQTSGERCAPGLLTFPSEFASVKPALRAFVA
TLFEENPFQFQPVFRGFYITSALQSGETRPLSDTRVVRRFGLEGDGPMPVRTASNHGFFLKDLFARVIFA
DRNLVRQYASRESVRLRLAFIATSLAMLGLALGAWGWSYMNNRELVANVEQDLIKIVHVQEGRQDLQSRM
EALEILQDRLEQLERFNDSHPISLGLGLYQGELVADKLRHELFAGVEGVMLKPVKENLERFLADVNQHAE
ELKAHELNSAPSIEAANRPYTEAVPTNVEDAYNALKTYLMLANREHVEVGHLSDQVTRFWRSWLEANRGA
MSREQMIRSGERILSAYLAHVNAADWPTITNNLAIVDQARDNLRNVVRGMPAAERVYADIKARASTRFPP
ISVANTVGPDNANLVAGSHVVSGAFTLEAWREYVEGAIKDAATGEQNSTDWVLRTAARDDLTLEGSPEQI
QKSLVAMYKADYAEEWKRFVQGVTIAEFETLPDATAAMNRLGDPQHSPIGTLLKLIFGQTSWDNPSIANV
GIERAQTGFIEWFKRSILRMAPSPVQLDVNVSAAKLEVPMGPIGREFAGLGRLMMPRDGSDPLINIYLKQ
LGQVRTRLNQLKNQGDPGPGATKLMRATLDGGESEFADTLRLVDEQMLTGLPDDQRTVLRPLLVRPIVQT
FHALVKPAEQEVNKTWQAQVVEPFNQKLAIKYPFASSAGIEATPTEIGQIFGPEGAIAKFVDASLGTLVV
RRGNTVAPRTWGDIGLTLRPEFVAGFARWVGPLEGAASNDGGGTQPQTVFMLLPHPSPGTTEYSVEIDGQ
KLLYRNGVAQWSNFVWPNPAGVPGARITATTFDGRVVEIVNIAGRFGLEKLINSAQRTRKPDGSFQLTWS
NDNTTISVDLRVVSNPQARAGDGNAANERGFAGLRLPEEVVGDPAGSAAPAAVAVAGNGPATR
 
Nucleotide Sequence: 3762 bp     [Download]
>gi|470168442|ref|NC_020516.1|:c1959136-1955375 Azoarcus sp. KH32C DNA, complete genome
ATGTTTTCCATTCGCTCCTTCCTGACTGACTCCCGCTTCCTTTCGTTCGTCGGCATTGGCGCGGCCGTAG
CGTTCTTCTTCCTGGGCGCCAAGACGCTGAAGGTCGCGCTCTTCTGGGCGGCACTGGCAAGCGGCCTGGT
CGTGCTCGCGTGGCTTGCGGTCTGGGCATTCCAGCGGTGGCGAGCCTCGAAGGCTTCCGATGCGATCGGC
AGGATGCTGGACGAACAGGGCGTGGCCGCGGCTTCGGCCAAGCACGCCGCGACCGAAGCGGATATCGCGA
CGTTGCGCGCGCGACTGCAAGAGGCGATCCGAACAATCCGTACGTCGAAGCTCGGCCAGACGGCCGGCTC
CGCAGCGCTGTACGAGCTCCCGTGGTACATCACGATCGGAAACCCGGCCGCAGGGAAGAGCAGCGCGATC
ATCAACTCGGGGCTCAAGTTTCCGTTCGACGATGGCGGCGCGCCTAACGTCCGGGGAATCGGCGGCACCC
GCAACTGCGACTGGTTCTTCACGACGGGCGGCATCCTCCTCGATACCGCCGGCCGCTACTCCGTGTATGA
AGACGACCGCGACGAGTGGCTGGGATTCCTGGATCTGCTGCGCAAGCACCGGCCGCGCGCGCCCATCAAC
GGCATCATCGTGACCGTCAGCATCGGAGAGCTGATCGGCAATCCCCCCGCGTTCGCAATCGGACTGGCGA
AAAATCTGCGGCAGCGGATTCAGGAGCTGACCGAAAGACTCCGTGTCTTTGCCCCGGTCTACGTGATGTT
TTCCAAGGCGGACCTGATCCCGGGATTCCATGAATTCTTCCAGGATGTGGACTGGAACGAACGCGACCGC
GTGTGGGGAGCGACTTTCCCCTACGAAGCACAGCCGCGAAATGATCTCGTCGCGCAATTCGATGCGCGCT
TCGACGAGCTGTACGAAGGACTGCGGGCGCTCAGTGTGGCGCTGCTGTCGCAGACGAGCGGAGAACGCTG
CGCTCCTGGACTGTTGACCTTCCCGTCCGAATTCGCGTCGGTCAAACCGGCGTTGCGCGCCTTTGTTGCC
ACCCTGTTCGAGGAAAACCCGTTCCAGTTCCAACCTGTCTTTCGCGGTTTCTACATCACCTCCGCGCTGC
AGAGTGGCGAAACGCGGCCGCTGTCGGACACGCGTGTCGTCCGGCGGTTCGGCCTCGAAGGCGACGGGCC
GATGCCCGTGCGCACGGCGTCCAACCACGGCTTCTTTCTCAAGGATCTCTTTGCCCGGGTGATCTTCGCG
GACCGCAACCTCGTGCGCCAATACGCCAGCCGGGAAAGCGTCCGGCTGCGCCTGGCCTTCATCGCCACCA
GCCTGGCAATGCTGGGGCTCGCGCTCGGGGCGTGGGGCTGGTCCTACATGAACAACCGCGAACTGGTTGC
CAACGTGGAGCAAGACCTGATCAAGATCGTCCATGTCCAGGAAGGGCGCCAGGACCTGCAATCACGCATG
GAGGCCTTGGAGATCCTTCAGGACCGCCTCGAACAACTCGAACGTTTCAACGATAGCCACCCGATTTCGC
TCGGCCTCGGCCTTTATCAGGGAGAGCTTGTCGCTGACAAGCTCAGGCATGAGCTCTTTGCCGGCGTCGA
GGGCGTCATGTTGAAACCCGTAAAGGAAAACCTCGAACGCTTCCTCGCGGATGTGAACCAACATGCGGAG
GAACTGAAGGCGCACGAGCTCAACAGCGCCCCATCCATCGAAGCAGCGAACCGTCCGTACACCGAAGCGG
TTCCGACCAACGTCGAAGATGCGTATAACGCATTGAAGACCTACCTGATGCTCGCGAACCGCGAGCACGT
CGAGGTCGGCCATCTCTCTGATCAGGTGACGCGCTTCTGGCGGAGTTGGCTCGAAGCAAACCGCGGTGCG
ATGAGCCGGGAACAGATGATCCGCAGCGGCGAGCGCATCCTGTCCGCCTATCTGGCACACGTCAACGCCG
CCGACTGGCCGACGATCACGAACAACCTCGCGATCGTGGACCAGGCCCGCGATAACCTTCGCAACGTAGT
GCGCGGAATGCCCGCTGCGGAACGCGTCTATGCCGACATCAAGGCCCGCGCCTCGACCCGCTTCCCGCCG
ATTTCGGTCGCAAACACCGTCGGACCGGACAATGCAAATCTGGTGGCCGGCAGCCATGTGGTATCGGGAG
CATTTACCCTGGAGGCGTGGCGCGAATATGTGGAAGGCGCGATCAAGGATGCTGCGACGGGCGAGCAGAA
CAGCACCGACTGGGTTCTGAGGACTGCCGCCCGCGACGATTTGACGCTCGAAGGCAGCCCCGAGCAGATC
CAGAAATCCCTCGTGGCGATGTACAAGGCCGATTACGCCGAAGAGTGGAAGCGATTCGTGCAGGGCGTGA
CGATTGCCGAGTTCGAAACCTTGCCGGACGCGACGGCGGCGATGAACCGCCTCGGCGACCCGCAGCATTC
GCCGATCGGAACGCTGCTGAAGCTCATCTTCGGTCAGACTTCATGGGATAACCCATCCATTGCGAACGTG
GGCATCGAACGCGCCCAGACCGGCTTCATCGAATGGTTCAAGCGTTCGATCCTGCGCATGGCGCCCAGCC
CGGTGCAACTCGACGTCAACGTGAGTGCCGCCAAACTCGAAGTCCCGATGGGTCCGATCGGCCGGGAGTT
TGCCGGCCTGGGCCGCTTAATGATGCCGCGCGACGGCAGCGATCCACTGATCAACATCTACCTGAAACAG
CTGGGCCAAGTCCGCACTCGGCTCAATCAATTGAAGAACCAGGGCGATCCGGGCCCCGGCGCGACCAAGC
TCATGCGGGCGACGCTCGACGGTGGCGAATCCGAGTTCGCGGATACCCTTCGGCTCGTCGACGAGCAGAT
GCTGACCGGTCTGCCAGACGATCAGCGCACCGTCTTACGACCGCTACTGGTCCGTCCGATTGTGCAGACC
TTCCATGCACTCGTAAAGCCGGCCGAACAGGAGGTGAACAAGACCTGGCAGGCGCAGGTTGTCGAACCGT
TCAACCAGAAACTCGCCATCAAGTACCCCTTCGCGTCATCGGCCGGCATCGAAGCGACACCAACGGAAAT
CGGACAGATCTTCGGTCCTGAAGGCGCGATCGCGAAGTTCGTCGATGCATCGCTCGGAACGCTCGTCGTC
CGCCGCGGCAACACGGTGGCGCCGCGTACTTGGGGCGATATCGGACTGACGCTGCGTCCCGAATTCGTCG
CGGGATTCGCGCGATGGGTCGGCCCGCTGGAAGGCGCGGCGTCGAACGATGGCGGCGGCACTCAGCCGCA
AACGGTGTTCATGCTGCTGCCGCACCCCTCGCCCGGCACCACCGAGTACAGCGTCGAAATCGACGGGCAA
AAGCTGCTCTATCGCAACGGTGTCGCGCAGTGGTCGAATTTCGTCTGGCCCAATCCTGCAGGGGTTCCCG
GAGCGCGCATCACTGCAACGACTTTCGACGGACGCGTGGTCGAGATCGTGAACATTGCGGGACGCTTCGG
TCTCGAGAAGCTGATCAACTCGGCACAACGTACCCGCAAGCCCGATGGCAGCTTCCAGCTCACGTGGTCG
AACGACAATACGACGATCAGCGTGGATCTTCGCGTCGTGAGCAATCCGCAGGCACGGGCCGGCGACGGCA
ACGCCGCCAACGAACGGGGTTTCGCGGGGCTGCGCCTGCCGGAGGAGGTGGTCGGCGATCCCGCCGGCAG
TGCCGCGCCCGCCGCAGTCGCCGTTGCCGGCAACGGCCCGGCTACGCGTTAA
 Primer design