SecReT6
Protein ID: 470170156
SecReT6 ID736
T6SS typei4b
Gene symbol-
Locus tagAZKH_1753
StrainAzoarcus sp. KH32C
Repliconchromosome [GenBank: NC_020516] [Browse all T6SS(s) in this replicon]
Location [Strand]1962638..1963408 [-]
Producthypothetical protein
NoteTssL
UniProt IDH0PSC7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.90E-54, Aligned region: 26..225
Protein Sequence: 256 a.a.     [Download]
>gi|470170156|ref|YP_007551042.1| hypothetical protein AZKH_1753 [Azoarcus sp. KH32C]
MTSPPSLFADAPSASLNDGTGTKPHSLVDLLYDGFHMLMLLHHQKTPKDAARFSESIQKFLDDFERLAKK
HDFDANDIFDAKYAFCAAVDESILASRINIRDDWERRPLQLALFGDQLAGEHFFDKLERARNEGAARIAA
LEVFHLCLLLGFKGKYLLEGPEKLKYLIAQLGEQLLHLKGKRAQFAPRWAAPDQIAHLLKWEMPIWGIGS
LIALLGLLAYVGLAMQAESNTHASLAGYDGLVQLTPRPPTLNITLP
 
Nucleotide Sequence: 771 bp     [Download]
>gi|470168442|ref|NC_020516.1|:c1963408-1962638 Azoarcus sp. KH32C DNA, complete genome
ATGACAAGTCCCCCTTCCCTGTTCGCCGACGCCCCAAGCGCCTCACTCAACGACGGGACCGGTACGAAGC
CGCATAGCCTGGTCGATCTCCTGTACGACGGATTTCACATGCTGATGCTCCTGCATCACCAGAAGACGCC
CAAGGATGCCGCGCGGTTCAGCGAGAGCATCCAGAAATTCCTGGACGATTTCGAACGCCTTGCAAAGAAG
CACGATTTTGACGCGAACGACATCTTCGATGCGAAATATGCATTTTGCGCTGCAGTGGACGAGTCGATCC
TGGCGTCCCGAATAAACATCCGTGACGATTGGGAGCGTCGTCCGCTACAGCTGGCGCTCTTCGGCGATCA
GCTCGCCGGCGAACACTTCTTCGACAAGCTCGAACGCGCCCGGAACGAGGGTGCCGCGAGGATTGCGGCT
CTTGAAGTGTTCCACCTGTGCCTACTCTTGGGCTTCAAGGGCAAGTACCTGCTGGAAGGTCCGGAAAAGC
TGAAGTATCTGATCGCTCAACTCGGCGAGCAACTCCTCCACCTCAAGGGAAAACGCGCCCAGTTTGCGCC
GCGTTGGGCGGCGCCGGACCAGATTGCTCATCTGCTGAAGTGGGAAATGCCGATCTGGGGAATCGGATCG
CTGATTGCCTTGCTCGGCCTGCTCGCATACGTCGGCCTCGCGATGCAGGCGGAAAGCAATACACATGCGT
CGCTCGCCGGCTATGACGGCCTGGTTCAGCTCACGCCGCGCCCGCCGACACTGAACATCACGCTTCCCTA
A
 Primer design