SecReT6
Protein ID: 470170157
SecReT6 ID736
T6SS typei4b
Gene symbol-
Locus tagAZKH_1754
StrainAzoarcus sp. KH32C
Repliconchromosome [GenBank: NC_020516] [Browse all T6SS(s) in this replicon]
Location [Strand]1963405..1964610 [-]
Producthypothetical protein
NoteTssK
UniProt IDH0PSC8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.40E-113, Aligned region: 2..399
Protein Sequence: 401 a.a.     [Download]
>gi|470170157|ref|YP_007551043.1| hypothetical protein AZKH_1754 [Azoarcus sp. KH32C]
MEVDSEALQSGTLRFNRIDVILPNGESFCAPAVDQLPPPLTLDPLVHEESGTEFYLALHQLRNHGGNCAS
DETQPGHARYLICGTERPDLYTDAADAEITVLRKISLLKAEQEPRDQFLTLPLIRVRRTSSRGFEHDLSF
VPPSISLGSSPLLTLMLRRQLEALQAKANALYGFHREPSKHIIEFRSGDIASFWLLHTVSSACAALMHLF
RNPEVHPERMYQELLRLAGGLMTFSRSYGLTDLPAYQHAQPGPAFLKLDAILRDLLDTVISTRYFSIALT
NPRPAYHAGHLDSDKITPDTAFYLAVSANHPLSEIIETIPFRLKVGAPDDVDKLVLSAMSGVRLTHAQHV
PAAIPVRPGACYFALDSHGALYERMLKTQSIAIYAPESYQDLKLELIAVTS
 
Nucleotide Sequence: 1206 bp     [Download]
>gi|470168442|ref|NC_020516.1|:c1964610-1963405 Azoarcus sp. KH32C DNA, complete genome
TTGGAAGTGGACAGCGAGGCGCTGCAAAGCGGTACGCTTCGTTTCAATCGCATCGACGTCATTCTCCCCA
ACGGCGAGTCGTTTTGCGCACCTGCGGTCGATCAGCTTCCGCCCCCCCTGACGCTCGATCCGCTCGTCCA
TGAAGAGAGCGGGACGGAGTTTTACCTTGCGCTCCACCAGCTTCGGAATCACGGGGGCAATTGCGCGAGT
GATGAAACCCAGCCGGGTCACGCCCGCTACCTGATCTGCGGCACGGAAAGGCCGGATCTATATACGGACG
CGGCCGACGCCGAAATCACCGTGCTTCGCAAGATATCCCTCCTCAAGGCCGAGCAGGAACCACGCGATCA
GTTCCTGACCTTGCCCCTCATCCGGGTGCGTCGCACATCGAGCAGAGGATTCGAGCACGATCTGTCATTT
GTGCCCCCGTCGATCTCGCTCGGAAGCTCGCCGCTTCTGACACTCATGCTGCGGCGCCAGTTGGAAGCCC
TGCAAGCCAAGGCCAACGCGCTCTATGGCTTCCACCGGGAACCGTCGAAACACATCATCGAGTTCCGCTC
GGGCGATATCGCGTCCTTCTGGCTCCTGCACACCGTCAGCAGTGCGTGCGCGGCCCTGATGCACCTGTTC
AGGAATCCGGAGGTTCACCCGGAACGCATGTACCAGGAGTTGCTGCGACTCGCGGGGGGACTCATGACCT
TTTCGCGCAGCTACGGCCTGACGGATCTGCCCGCGTATCAACACGCGCAACCCGGCCCGGCCTTTCTGAA
GCTCGATGCGATCCTGCGCGATCTGCTCGATACCGTCATCTCGACGCGCTATTTCTCGATAGCACTCACC
AATCCCAGACCGGCGTACCACGCCGGCCACCTCGATTCGGACAAGATCACACCGGACACAGCGTTCTATC
TTGCAGTCTCGGCCAACCATCCCTTGTCGGAAATCATCGAGACGATTCCGTTCCGGCTGAAAGTGGGCGC
GCCCGATGATGTGGACAAGCTCGTCCTTTCGGCGATGTCCGGCGTCCGCCTGACACACGCCCAACACGTA
CCCGCCGCCATTCCAGTGCGCCCCGGCGCGTGCTACTTCGCCCTTGACTCGCACGGAGCGCTCTATGAGC
GGATGCTGAAGACGCAATCCATCGCCATCTACGCTCCGGAGAGCTACCAGGACCTGAAACTCGAACTCAT
TGCCGTCACGTCATGA
 Primer design