SecReT6
Protein ID: 470170159
SecReT6 ID736
T6SS typei4b
Gene symbol-
Locus tagAZKH_1756
StrainAzoarcus sp. KH32C
Repliconchromosome [GenBank: NC_020516] [Browse all T6SS(s) in this replicon]
Location [Strand]1964762..1965277 [-]
Producthypothetical protein
NoteTssJ
UniProt IDH0PSD0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.10E-29, Aligned region: 15..139
Protein Sequence: 171 a.a.     [Download]
>gi|470170159|ref|YP_007551045.1| hypothetical protein AZKH_1756 [Azoarcus sp. KH32C]
MSFALESAGLGEKKDEHKEEASYQVPLRIQAGEQLNLSADGKPLSLVVKIYQLSATEAFNRMTYAQANAA
DEERAALAEELVSSREVVLIPGRTYELPQTLSPRATAIGIVGQFRAPSTGRWKLAFDARASKDKGIAVGA
LACALATGAGIVINQAPAESARSPAGTRCNA
 
Nucleotide Sequence: 516 bp     [Download]
>gi|470168442|ref|NC_020516.1|:c1965277-1964762 Azoarcus sp. KH32C DNA, complete genome
GTGTCCTTTGCGCTCGAATCGGCGGGACTCGGCGAAAAGAAGGACGAACACAAAGAGGAAGCAAGCTATC
AGGTTCCCCTGCGCATCCAGGCCGGAGAACAGCTGAACCTGTCGGCCGACGGGAAGCCCCTTTCATTGGT
CGTCAAGATCTACCAACTGAGTGCGACAGAGGCGTTCAACCGCATGACGTATGCACAAGCGAATGCAGCG
GACGAAGAAAGAGCAGCGCTGGCCGAAGAGCTGGTGTCGTCACGCGAAGTTGTACTGATCCCGGGGCGAA
CCTATGAATTGCCCCAGACGCTGTCACCCCGGGCAACTGCGATTGGCATCGTCGGTCAGTTCCGGGCGCC
TTCAACCGGGCGATGGAAACTGGCCTTCGACGCACGAGCCTCCAAGGACAAAGGCATCGCGGTCGGCGCC
CTTGCATGCGCCCTCGCAACCGGCGCGGGCATCGTGATCAATCAAGCCCCGGCGGAATCGGCAAGATCAC
CAGCCGGCACCCGCTGCAACGCATAG
 Primer design