SecReT6
Protein ID: 470170161
SecReT6 ID736
T6SS typei4b
Gene symbol-
Locus tagAZKH_1758
StrainAzoarcus sp. KH32C
Repliconchromosome [GenBank: NC_020516] [Browse all T6SS(s) in this replicon]
Location [Strand]1966318..1966800 [+]
Producthypothetical protein
NoteTssB
UniProt IDH0PSD2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-54, Aligned region: 2..154
Protein Sequence: 160 a.a.     [Download]
>gi|470170161|ref|YP_007551047.1| hypothetical protein AZKH_1758 [Azoarcus sp. KH32C]
MQKVRPPRVQLTYDVERGDALEQKELPFVVGVLGDFAVQSGQALGKLRDRKFVNVDLDNLDDVMAGLAPR
VAFRAPNMLSPQGGELGLDLTFRSFEDFRPESVAQQVEPLRKLLEARSKLADLRNKLAGNEKLEDCLNEV
LRNSEQLESLGAKSGEETEQ
 
Nucleotide Sequence: 483 bp     [Download]
>gi|470168442|ref|NC_020516.1|:1966318-1966800 Azoarcus sp. KH32C DNA, complete genome
TTGCAGAAGGTGAGGCCGCCTCGCGTTCAGCTGACTTACGACGTCGAGAGGGGTGATGCGCTCGAGCAGA
AGGAACTGCCCTTCGTCGTCGGCGTGCTGGGGGACTTCGCTGTACAAAGCGGCCAGGCACTCGGAAAGTT
GCGAGATCGCAAGTTCGTCAATGTCGACCTCGACAACCTCGACGACGTCATGGCCGGGCTCGCGCCTCGC
GTCGCATTTCGTGCTCCGAACATGCTGTCGCCCCAAGGCGGAGAACTGGGGCTCGATCTGACTTTCCGGA
GTTTCGAGGATTTTCGCCCCGAATCCGTCGCCCAGCAGGTCGAGCCACTGCGGAAGCTGCTCGAGGCGCG
GTCGAAGCTCGCCGACCTGCGCAACAAACTCGCAGGCAACGAGAAGCTCGAAGACTGCCTGAACGAGGTT
CTCAGGAACAGCGAGCAGCTCGAAAGCCTCGGCGCGAAATCCGGTGAGGAGACCGAGCAATGA
 Primer design