SecReT6
Protein ID: 470170162
SecReT6 ID736
T6SS typei4b
Gene symbol-
Locus tagAZKH_1759
StrainAzoarcus sp. KH32C
Repliconchromosome [GenBank: NC_020516] [Browse all T6SS(s) in this replicon]
Location [Strand]1966797..1968275 [+]
Producthypothetical protein
NoteTssC
UniProt IDH0PSD3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.50E-188, Aligned region: 66..487
Protein Sequence: 492 a.a.     [Download]
>gi|470170162|ref|YP_007551048.1| hypothetical protein AZKH_1759 [Azoarcus sp. KH32C]
MTMHAGVQSAVAAPAATVLLDRIIEESRVARSDQERERARDIISELASQVLEGEVLISENLAASLDARVA
ELDRLISEQLSAIMHAPAFQQLESAWTGLHYLCKQTSTQVRIKLMNASKNELIKDFKTAIDFDQSALFKK
VYEEEFGTFGGAPFGTLIGQFELTRQPEDMYFVEQMSHVAAAAHAPFIAAASPELFGLDSYTELGKPRDL
AKVFDTVEYAKWKSFRDSEDARYVGLALPRFLGRLPYNPIDGVTTEGFNFVEDVDGSDHDKYLWCSAAFA
FGARLTSAFENFGWCAAIRGVEGGGLVEDLPTHTFRTDDGEVALKCPTEVAVTDRREKELSDLGFIPLVH
CKNTDYAAFFGAQSAQKPKKYDSDAANANASLSAQLQYIFAVSRIAHYMKAMMRDKIGSFASPANVQGYL
QRWIDQYVTADDSASQETKAQFPLREASVEVSEVPGRAGVYRAVAFIRPHFQLDELSVSLRLVAELPGAG
QG
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|470168442|ref|NC_020516.1|:1966797-1968275 Azoarcus sp. KH32C DNA, complete genome
ATGACGATGCACGCGGGTGTTCAATCGGCAGTCGCTGCGCCGGCAGCCACTGTGCTGCTTGACAGGATCA
TCGAGGAAAGCCGCGTCGCGCGTTCCGATCAGGAGCGCGAACGGGCTCGGGACATCATCAGCGAACTCGC
CAGCCAGGTCCTGGAGGGCGAGGTCCTGATCTCCGAAAACCTTGCCGCGTCGCTCGACGCGCGGGTCGCG
GAGTTGGATCGGCTGATCTCCGAGCAACTGAGCGCAATCATGCACGCTCCCGCATTTCAGCAGCTGGAAA
GCGCCTGGACCGGCTTGCACTACCTGTGCAAGCAGACGTCGACCCAGGTCCGGATAAAGCTGATGAATGC
GTCGAAGAACGAGTTGATCAAGGATTTCAAGACGGCGATCGATTTCGACCAGAGCGCGCTCTTCAAGAAG
GTCTACGAGGAGGAGTTCGGAACCTTCGGCGGCGCCCCCTTCGGTACCTTGATCGGTCAGTTCGAACTGA
CGCGGCAGCCGGAGGACATGTATTTTGTCGAACAGATGTCCCATGTCGCCGCTGCGGCTCATGCGCCCTT
CATCGCTGCCGCATCGCCCGAACTGTTCGGCCTCGATTCCTATACCGAACTGGGTAAGCCCCGTGATCTC
GCGAAGGTGTTCGATACCGTCGAGTACGCGAAGTGGAAATCGTTCCGGGACTCCGAGGACGCACGCTACG
TGGGCCTGGCGCTGCCGCGCTTTCTCGGGCGGCTGCCCTACAACCCGATCGATGGCGTCACCACCGAAGG
GTTCAACTTCGTCGAGGACGTCGATGGTTCGGATCACGACAAATACCTGTGGTGCAGCGCGGCGTTCGCC
TTCGGGGCGCGCCTGACCAGCGCATTCGAGAATTTCGGCTGGTGCGCCGCGATCCGTGGCGTCGAAGGGG
GCGGCTTGGTCGAGGACTTGCCGACTCACACCTTCCGCACTGACGACGGAGAAGTGGCCTTGAAGTGCCC
CACCGAGGTCGCGGTGACGGATCGACGCGAGAAGGAACTGAGCGACCTTGGTTTCATTCCGTTGGTCCAT
TGCAAGAACACCGATTACGCCGCGTTCTTTGGTGCCCAATCCGCGCAGAAGCCCAAGAAATATGACAGCG
ACGCGGCGAACGCAAACGCGTCGCTTTCGGCGCAACTGCAATACATCTTCGCCGTGTCGCGAATCGCCCA
TTACATGAAAGCGATGATGCGCGACAAGATCGGCAGCTTTGCGTCGCCCGCAAATGTCCAGGGCTATCTG
CAGCGCTGGATCGACCAATACGTCACCGCCGACGACTCGGCGTCGCAGGAAACCAAGGCGCAGTTCCCAT
TGCGGGAAGCTTCGGTCGAAGTGAGCGAGGTGCCGGGGCGAGCGGGCGTATACCGCGCCGTTGCGTTCAT
CCGTCCGCATTTCCAGCTCGACGAGCTTTCGGTGTCCTTGCGTCTCGTCGCCGAGTTGCCCGGTGCCGGT
CAGGGTTGA
 Primer design