SecReT6
Protein ID: 470170163
SecReT6 ID736
T6SS typei4b
Gene symbol-
Locus tagAZKH_1760
StrainAzoarcus sp. KH32C
Repliconchromosome [GenBank: NC_020516] [Browse all T6SS(s) in this replicon]
Location [Strand]1968315..1968851 [+]
Producthypothetical protein
NoteTssD
UniProt IDH0PSD4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.80E-48, Aligned region: 5..150
Protein Sequence: 178 a.a.     [Download]
>gi|470170163|ref|YP_007551049.1| hypothetical protein AZKH_1760 [Azoarcus sp. KH32C]
MKDIYIEFKGSDIKGDSRDTRHKDTVEVYSWTHQMRQPKSATASAAGGHTAERVEHGEMIFTKDIDGASP
KLYQACSSGLVVNDVIIYFYRAFGGKNTTGNPSSTQSRHQFMKIELKNVIIGSISPSVSGEGIPQESFSL
KYSAVKWTYDELNIDGTKSGKVNIQGAWNLAKNTPNLT
 
Nucleotide Sequence: 537 bp     [Download]
>gi|470168442|ref|NC_020516.1|:1968315-1968851 Azoarcus sp. KH32C DNA, complete genome
ATGAAGGACATTTACATCGAATTCAAGGGAAGCGACATCAAGGGCGATTCCCGCGATACGCGCCACAAGG
ATACCGTCGAGGTCTATAGCTGGACGCACCAGATGCGCCAACCGAAGTCGGCCACCGCGTCGGCTGCGGG
CGGGCACACCGCGGAACGTGTCGAACATGGGGAAATGATCTTCACGAAGGATATCGACGGCGCGAGCCCC
AAGCTGTACCAGGCGTGTTCGTCGGGCCTCGTCGTCAATGATGTGATCATCTACTTCTACCGTGCCTTCG
GCGGCAAGAACACCACCGGCAATCCGTCTTCGACGCAGAGCCGGCATCAGTTCATGAAGATCGAGCTCAA
GAACGTCATCATTGGTTCCATTTCACCGAGCGTGAGTGGAGAAGGGATCCCGCAGGAAAGCTTCTCGCTG
AAGTACTCCGCGGTGAAGTGGACCTACGACGAACTCAATATCGACGGAACCAAGTCGGGCAAGGTCAATA
TCCAGGGCGCTTGGAACCTGGCGAAGAACACGCCGAACCTGACTTGA
 Primer design