SecReT6
Protein ID: 470170164
SecReT6 ID736
T6SS typei4b
Gene symbol-
Locus tagAZKH_1761
StrainAzoarcus sp. KH32C
Repliconchromosome [GenBank: NC_020516] [Browse all T6SS(s) in this replicon]
Location [Strand]1968916..1969395 [+]
Producthypothetical protein
NoteTssE
UniProt IDH0PSD5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.70E-21, Aligned region: 26..134
Protein Sequence: 159 a.a.     [Download]
>gi|470170164|ref|YP_007551050.1| hypothetical protein AZKH_1761 [Azoarcus sp. KH32C]
MKGFEPSLFDKLFDDVPMLATRRRLSLEELKDSVARDLEALLNARTILDDEAMGDFPQVSDSVATFGLSD
FAGLSLASVHDRFRICGSIERTIARHEPRLRAVQVTLELNRQSTNALYFSIRAVLVVRPAQEPVSFDALL
QPTTLQYSVNKQRLRGVAS
 
Nucleotide Sequence: 480 bp     [Download]
>gi|470168442|ref|NC_020516.1|:1968916-1969395 Azoarcus sp. KH32C DNA, complete genome
ATGAAGGGATTCGAACCGTCGCTATTCGACAAGCTCTTCGACGATGTGCCGATGCTCGCTACGCGTCGTC
GTCTTTCCCTCGAGGAATTGAAGGACTCCGTCGCACGAGATCTTGAAGCGCTGTTGAATGCGCGCACGAT
ACTTGACGACGAGGCGATGGGGGACTTTCCTCAAGTTTCCGACTCGGTCGCAACCTTCGGGCTGAGCGAC
TTCGCTGGACTGAGCCTGGCCAGCGTGCATGATCGTTTCCGGATCTGCGGCTCGATCGAAAGGACCATTG
CGCGTCACGAACCGCGCCTCAGGGCCGTTCAGGTGACTCTGGAACTCAATCGTCAATCGACCAATGCACT
CTATTTTTCGATTCGGGCCGTGCTGGTCGTGAGACCGGCGCAAGAACCGGTGAGCTTCGACGCCTTGTTG
CAACCCACGACATTGCAGTATTCCGTGAACAAACAGCGACTGCGTGGAGTGGCATCCTGA
 Primer design