SecReT6
Protein ID: 470170165
SecReT6 ID736
T6SS typei4b
Gene symbol-
Locus tagAZKH_1762
StrainAzoarcus sp. KH32C
Repliconchromosome [GenBank: NC_020516] [Browse all T6SS(s) in this replicon]
Location [Strand]1969396..1971234 [+]
Producthypothetical protein
NoteTssF
UniProt IDH0PSD6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.70E-194, Aligned region: 4..611
Protein Sequence: 612 a.a.     [Download]
>gi|470170165|ref|YP_007551051.1| hypothetical protein AZKH_1762 [Azoarcus sp. KH32C]
MEELLPYYERELGFLRRHAREFAERYPKIAAQLLISGEGCDDPHVERMIESLALLNARVTKRLEDSYPQF
TEALLNVLYPHYLRPFPSCSIAYFDTEGNAQALSAPVSIPRGTELHSRPVKGAVCRFRTAWSVDLVPVQV
ADATFEPVIRAPADLALPLGSCALLSLTLEMPRGEGTQANIGQFPLRFYIDAEPSVAAAVRDALFLKLAK
PFVMGEDGRWVACPEDLIGEVGFADDEALIDMPASSHRAYRHLTEYFAFPEKYNFFDVALPRLCPSVRAA
TRITLLLVMKELRADSDASRLLQTLTAKNFRLGCVPVVNLFPQRGDPIRVTERVSSYPVVADGRRAFAYE
VYSIDAVRRVRQSSAGETVVEFRPLFSLQHGEDVGRHGNYWYAQRNGLVAGRSPGYETEISLVDSDVDPI
QQKADVLSIQLTCTNRELPTFMSVGLPSGDLFVEGGSVAKSIRLLRKPSQPYRFDLHGDGQWRLISHLSL
NHLSLSGSGVAAFREMLALYDLPRSASSRRRIEGILAIEQAEKTVWMAGRPFATFVRGLEVRITVDEANF
VGSGLDLFAQCIDRFLGLYAHLNSFVQLVLLSGRTGEELIRCVPRTGESILG
 
Nucleotide Sequence: 1839 bp     [Download]
>gi|470168442|ref|NC_020516.1|:1969396-1971234 Azoarcus sp. KH32C DNA, complete genome
ATGGAGGAACTGCTTCCATATTACGAGCGGGAACTGGGATTTCTGCGTCGGCATGCGCGGGAGTTTGCTG
AGCGATATCCGAAGATCGCGGCGCAGTTGCTGATCTCCGGCGAAGGCTGCGACGATCCGCATGTTGAGCG
GATGATCGAATCCTTGGCGCTGTTGAATGCGCGAGTCACCAAGAGACTCGAGGACAGCTATCCTCAGTTC
ACTGAGGCGCTCCTCAACGTTCTGTATCCGCATTATCTGCGACCGTTTCCGTCCTGTTCGATCGCGTATT
TCGATACCGAGGGCAACGCTCAGGCTCTGTCGGCCCCTGTGAGCATCCCTCGGGGGACGGAACTGCATTC
GCGCCCGGTAAAGGGCGCGGTCTGCCGGTTCCGTACCGCCTGGTCAGTGGATCTCGTACCCGTGCAGGTG
GCCGATGCGACCTTTGAGCCCGTCATACGCGCGCCCGCAGACCTTGCATTGCCCCTCGGCAGTTGCGCGC
TGCTGTCGCTGACTCTTGAAATGCCGAGGGGTGAGGGCACCCAGGCGAACATCGGCCAGTTTCCGTTGCG
GTTCTACATCGACGCCGAACCGTCCGTGGCGGCCGCGGTACGGGATGCCTTGTTCCTCAAGCTCGCTAAG
CCATTCGTCATGGGAGAGGACGGAAGATGGGTGGCGTGCCCGGAAGATTTGATCGGTGAGGTCGGATTCG
CCGATGATGAGGCGCTGATCGACATGCCGGCCAGTTCTCATCGGGCCTATCGGCACTTGACTGAATATTT
CGCCTTCCCGGAGAAGTACAACTTCTTCGACGTCGCCCTGCCGCGACTGTGCCCATCCGTACGCGCGGCG
ACCCGGATTACGCTGCTGCTGGTGATGAAGGAACTGCGCGCGGACAGCGATGCCTCGCGCCTGCTGCAAA
CACTCACGGCGAAGAATTTCAGGTTGGGGTGCGTGCCGGTCGTGAATCTTTTTCCGCAACGGGGCGATCC
GATCCGCGTTACTGAAAGAGTGTCAAGCTACCCGGTCGTGGCGGATGGTCGCCGTGCATTCGCCTACGAG
GTCTACTCGATCGACGCCGTGCGACGCGTACGCCAGTCCTCCGCCGGGGAAACGGTCGTCGAGTTTCGGC
CCTTGTTCTCGCTGCAGCATGGCGAGGATGTGGGTCGTCATGGCAACTACTGGTATGCGCAGCGCAATGG
GTTGGTGGCTGGAAGAAGCCCGGGGTACGAGACGGAAATTTCGCTAGTCGATTCCGATGTTGATCCCATT
CAGCAGAAGGCCGACGTCCTGAGCATCCAGCTCACGTGTACTAACCGGGAGTTGCCGACGTTCATGTCGG
TGGGCTTGCCGTCGGGGGATCTGTTTGTCGAAGGCGGATCCGTCGCGAAGTCGATTCGGCTGTTGCGCAA
ACCGAGCCAACCGTATCGCTTCGACCTCCATGGCGATGGCCAGTGGCGCCTGATTTCCCATCTCTCGCTG
AATCATTTGTCTCTGAGCGGAAGCGGTGTTGCTGCATTTCGCGAGATGCTGGCGCTCTATGATTTGCCGC
GCTCCGCTTCGTCGCGGCGACGCATCGAGGGCATCCTCGCGATCGAGCAGGCGGAAAAGACGGTTTGGAT
GGCGGGCCGGCCGTTCGCGACGTTTGTGCGCGGATTGGAGGTCAGGATCACCGTGGACGAGGCCAATTTC
GTGGGCAGCGGTCTGGATCTCTTTGCCCAATGCATAGACCGCTTCCTAGGCTTGTACGCCCATTTGAACA
GTTTCGTGCAACTGGTGCTGCTATCCGGCAGGACCGGTGAGGAGTTGATCCGATGCGTCCCACGTACCGG
CGAATCGATCCTGGGCTGA
 Primer design