SecReT6
Protein ID: 470170166
SecReT6 ID736
T6SS typei4b
Gene symbol-
Locus tagAZKH_1763
StrainAzoarcus sp. KH32C
Repliconchromosome [GenBank: NC_020516] [Browse all T6SS(s) in this replicon]
Location [Strand]1971198..1972256 [+]
Producthypothetical protein
NoteTssG
UniProt IDH0PSD7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.50E-90, Aligned region: 19..332
Protein Sequence: 352 a.a.     [Download]
>gi|470170166|ref|YP_007551052.1| hypothetical protein AZKH_1763 [Azoarcus sp. KH32C]
MRPTYRRIDPGLIEQLASAPQRFEFFQAVRLLERVFAAREGRLPRERPLESIRFRNSTALAFAPSQIEAV
ECHRRVDAEGQESGELERIEITPSFIGMLGIHGTLPSHYTERVADRERFHKDRAARAFFDLFSNRAVGNF
YRAWKKYRLPVAYEQDRRQSFLPMVLALAGLGFDALRDRFQSDSGGVDDEVIAHFAGVLRQRPLSAAVLQ
DVLAGYFRVPLRVEQFVGKWYALPLDQRSTLGGTNAALGASMLLGERVWQRSLRIRIWIGPLADDMHAQF
LPRGERAAALEKLLSLSTGHHFEYEIRPILHADHVRPARLGGGMRLGFDSFILTRPADTDRDDPMFESHP
VH
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|470168442|ref|NC_020516.1|:1971198-1972256 Azoarcus sp. KH32C DNA, complete genome
ATGCGTCCCACGTACCGGCGAATCGATCCTGGGCTGATCGAGCAACTCGCGTCGGCACCGCAGCGATTCG
AGTTCTTCCAGGCGGTCCGGCTACTAGAGCGGGTATTTGCAGCCCGGGAGGGGCGTCTTCCCCGTGAACG
GCCCTTGGAGTCGATCCGCTTCCGCAATTCAACAGCGCTTGCGTTCGCCCCAAGCCAGATCGAAGCGGTC
GAGTGCCACCGTCGCGTCGATGCCGAAGGGCAGGAGAGCGGCGAGCTGGAGCGGATCGAGATTACGCCCA
GTTTCATCGGCATGTTGGGCATTCACGGTACGCTGCCGTCCCATTACACGGAGCGCGTTGCCGACCGCGA
GCGCTTTCACAAGGACCGTGCTGCCCGCGCCTTTTTTGATCTCTTCTCCAATCGGGCGGTTGGTAATTTC
TATCGTGCTTGGAAGAAATACCGCCTGCCGGTCGCCTATGAGCAAGACCGGCGCCAGTCCTTCCTGCCTA
TGGTCCTTGCGCTCGCCGGTCTGGGCTTCGATGCACTGCGGGATCGATTTCAAAGCGACTCGGGCGGCGT
CGATGATGAAGTCATCGCGCATTTCGCCGGCGTGCTGCGGCAGCGTCCGCTGTCGGCCGCAGTGCTGCAG
GACGTGCTCGCAGGCTATTTTCGTGTGCCGCTGCGGGTCGAGCAATTCGTCGGGAAGTGGTATGCGCTGC
CGCTGGACCAGCGTTCGACGCTCGGCGGAACGAACGCCGCTTTAGGGGCCTCGATGCTGCTGGGCGAACG
CGTGTGGCAGCGAAGCCTGCGCATTCGAATCTGGATCGGGCCACTTGCCGACGACATGCACGCCCAATTC
CTTCCGCGGGGCGAGCGGGCGGCTGCGTTGGAGAAGCTGTTGTCGCTTTCGACCGGACATCACTTCGAAT
ACGAGATCCGACCTATCCTGCATGCAGATCATGTCCGCCCTGCGCGGCTCGGCGGCGGAATGCGGCTCGG
TTTCGACAGTTTCATCCTCACACGTCCCGCGGATACGGATCGTGACGATCCGATGTTCGAATCGCACCCT
GTCCATTGA
 Primer design