SecReT6
Protein ID: 470170167
SecReT6 ID736
T6SS typei4b
Gene symbol-
Locus tagAZKH_1764
StrainAzoarcus sp. KH32C
Repliconchromosome [GenBank: NC_020516] [Browse all T6SS(s) in this replicon]
Location [Strand]1972277..1974979 [+]
Productputative ATP-dependent Clp protease
NoteTssH
UniProt IDH0PSD8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.80E-45, Aligned region: 234..312
AAA_2 [PF07724], Evalue: 8.80E-45, Aligned region: 629..798
AAA [PF00004], Evalue: 5.70E-19, Aligned region: 235..348
AAA [PF00004], Evalue: 5.70E-19, Aligned region: 635..766
AAA_5 [PF07728], Evalue: 2.90E-13, Aligned region: 235..254
AAA_5 [PF07728], Evalue: 2.90E-13, Aligned region: 319..365
AAA_5 [PF07728], Evalue: 2.90E-13, Aligned region: 634..755
AAA_16 [PF13191], Evalue: 2.60E-11, Aligned region: 41..74
AAA_16 [PF13191], Evalue: 2.60E-11, Aligned region: 212..251
AAA_16 [PF13191], Evalue: 2.60E-11, Aligned region: 279..313
AAA_16 [PF13191], Evalue: 2.60E-11, Aligned region: 605..671
AAA_16 [PF13191], Evalue: 2.60E-11, Aligned region: 701..723
ClpB_D2-small [PF10431], Evalue: 7.50E-11, Aligned region: 805..881
Clp_N [PF02861], Evalue: 1.20E-10, Aligned region: 25..74
Clp_N [PF02861], Evalue: 1.20E-10, Aligned region: 114..124
Clp_N [PF02861], Evalue: 1.20E-10, Aligned region: 401..414
AAA_22 [PF13401], Evalue: 3.40E-07, Aligned region: 234..322
AAA_22 [PF13401], Evalue: 3.40E-07, Aligned region: 631..655
AAA_22 [PF13401], Evalue: 3.40E-07, Aligned region: 696..728
AAA_25 [PF13481], Evalue: 7.50E-06, Aligned region: 233..259
AAA_25 [PF13481], Evalue: 7.50E-06, Aligned region: 289..331
AAA_25 [PF13481], Evalue: 7.50E-06, Aligned region: 540..579
AAA_25 [PF13481], Evalue: 7.50E-06, Aligned region: 620..652
AAA_17 [PF13207], Evalue: 1.90E-05, Aligned region: 85..107
AAA_17 [PF13207], Evalue: 1.90E-05, Aligned region: 235..299
AAA_17 [PF13207], Evalue: 1.90E-05, Aligned region: 634..671
Sigma54_activat [PF00158], Evalue: 4.30E-05, Aligned region: 231..251
Sigma54_activat [PF00158], Evalue: 4.30E-05, Aligned region: 629..752
AAA_29 [PF13555], Evalue: 0.0002, Aligned region: 228..251
AAA_29 [PF13555], Evalue: 0.0002, Aligned region: 629..659
AAA_29 [PF13555], Evalue: 0.0002, Aligned region: 738..761
IstB_IS21 [PF01695], Evalue: 0.00032, Aligned region: 229..254
IstB_IS21 [PF01695], Evalue: 0.00032, Aligned region: 634..652
AAA_19 [PF13245], Evalue: 0.00049, Aligned region: 235..257
AAA_19 [PF13245], Evalue: 0.00049, Aligned region: 632..656
AAA_18 [PF13238], Evalue: 0.0023, Aligned region: 235..254
AAA_18 [PF13238], Evalue: 0.0023, Aligned region: 636..661
NACHT [PF05729], Evalue: 0.0023, Aligned region: 235..261
NACHT [PF05729], Evalue: 0.0023, Aligned region: 635..656
Zeta_toxin [PF06414], Evalue: 0.0032, Aligned region: 235..255
Zeta_toxin [PF06414], Evalue: 0.0032, Aligned region: 624..674
SRP54 [PF00448], Evalue: 0.0041, Aligned region: 235..255
SRP54 [PF00448], Evalue: 0.0041, Aligned region: 633..666
ResIII [PF04851], Evalue: 0.0077, Aligned region: 229..255
ResIII [PF04851], Evalue: 0.0077, Aligned region: 304..316
ResIII [PF04851], Evalue: 0.0077, Aligned region: 606..655
MobB [PF03205], Evalue: 0.0081, Aligned region: 236..253
MobB [PF03205], Evalue: 0.0081, Aligned region: 633..666
Protein Sequence: 900 a.a.     [Download]
>gi|470170167|ref|YP_007551053.1| putative ATP-dependent Clp protease [Azoarcus sp. KH32C]
MSTSLKTLISKLNNTSRKAAERAAGLCMGRGNYEVDLEHLFLALLEQRDSDVYVIARRCGISPSALERDL
MREIEGFKSGNSRTPVFSPHLPRLFEQAWLLASLDERLPRIRSGHLLLALLTEPELSQLALRGSPLFAQV
KLAELKHNFSALTDGSAEATEAIGLLADSATVASAQNVDGRTTGRDGAATPALDQFTTNLTQRARDGKVD
PVIGRDSEIRLVIDILMRRRQNNPILTGEAGVGKTAVVEGLALRVASGDVPPPLQEVELHVLDMGLLQAG
ASVKGEFENRLKNVIDEVKGSLRPIVLFIDEAHTMIGAGGQSGQNDAANLLKPALARGELRTIAATTWAE
YKKYFEKDAALARRFQVVRVEEPTEPMAAAMLRGMVPLMESHFGIRVLDEAVTEAVRLSHRYISGRQLPD
KAISLLDTACAKVALGQSSIPALIDDDEKRLLRNRTELAVLEREATTGAGHDARLGELREQIAAIECDLA
IRKARFDEERTLVEEILGLRRGMEDPMEQVGADVAHAEDPRRAIGRRSAKDELDALMSRLRDMQGETPMV
PLHVDGHVVAEIVAAWTGIPLGKMVKDEIRTVLKLKPLLQERVIGQDHALEAVAQRVRTARANLEDPNKP
KGVFMFVGPSGVGKTETALALADILYGGERKLVTINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVR
RNPYSVVLLDEVEKAHPDVLELFFQVFDKGVLDDAEGREIDFRNTLIILTSNVGSSQIMQACLNRSGEEM
PSAEDLGASLRPVLCKAFKPAFLGRMQVVAYYPISDEVLAQIIVLKLGRIRDRIATNHKAAFVWDEKLVG
AVLARCTEVDSGARNVDHILNGTLLPEIAEAVLARMADGAQIQRIRVTALKSGEFRYSIK
 
Nucleotide Sequence: 2703 bp     [Download]
>gi|470168442|ref|NC_020516.1|:1972277-1974979 Azoarcus sp. KH32C DNA, complete genome
ATGAGTACTTCCCTTAAGACACTGATCAGCAAACTCAACAACACCAGTCGCAAGGCTGCGGAACGTGCCG
CGGGCCTTTGCATGGGACGTGGCAACTACGAGGTGGACTTGGAACACTTGTTCCTGGCACTGCTTGAGCA
GCGTGACAGCGATGTGTATGTAATCGCCAGGCGCTGCGGAATTAGTCCGTCCGCTCTGGAACGGGACTTG
ATGCGGGAGATCGAGGGATTCAAGAGTGGAAATTCGCGTACGCCCGTCTTCTCCCCGCATCTGCCCCGTC
TGTTCGAGCAGGCGTGGTTGCTTGCCTCACTGGATGAACGGTTGCCTCGTATCCGCTCTGGCCATTTGCT
GCTCGCGCTGCTGACGGAACCCGAACTGTCGCAACTGGCCTTGCGCGGGTCGCCCCTGTTCGCACAGGTC
AAATTGGCCGAGCTGAAGCACAACTTTTCGGCACTAACGGATGGTTCTGCCGAGGCAACTGAAGCAATTG
GCTTGTTGGCGGACTCAGCTACGGTCGCCTCCGCCCAAAATGTCGACGGTCGGACGACAGGCAGAGATGG
CGCAGCGACTCCGGCTCTGGATCAATTCACGACCAATTTGACGCAACGTGCCCGGGACGGCAAGGTCGAT
CCGGTGATCGGTCGCGATAGTGAGATTCGGCTCGTGATCGACATCCTGATGCGCCGGCGGCAGAACAATC
CGATCCTGACCGGCGAGGCCGGAGTGGGCAAGACCGCCGTCGTAGAGGGGCTCGCACTGAGAGTGGCATC
CGGCGACGTGCCGCCGCCCTTGCAGGAGGTCGAGCTTCATGTGCTCGACATGGGCTTGCTGCAGGCGGGG
GCAAGCGTGAAGGGTGAGTTCGAAAATCGTCTCAAGAACGTCATCGACGAGGTGAAAGGGAGTCTCAGGC
CCATCGTGCTCTTCATCGACGAAGCCCATACGATGATCGGTGCGGGAGGGCAGTCGGGCCAGAACGACGC
GGCCAATTTGCTCAAGCCGGCGCTGGCCCGCGGGGAGTTGCGCACCATCGCTGCCACCACGTGGGCGGAG
TACAAGAAATACTTCGAGAAGGATGCTGCGCTGGCTCGTCGCTTCCAGGTGGTCAGGGTCGAGGAGCCCA
CGGAACCGATGGCGGCGGCGATGCTGCGCGGGATGGTGCCGTTGATGGAAAGCCATTTCGGGATCCGCGT
GTTGGACGAGGCGGTGACCGAGGCGGTCCGGCTGTCCCACCGCTACATCAGCGGCCGTCAGCTGCCGGAC
AAGGCGATCAGCCTGCTGGATACCGCGTGCGCGAAGGTCGCGCTGGGACAGAGTTCGATTCCCGCGCTCA
TCGACGACGACGAAAAGCGATTGCTACGCAACCGGACGGAATTGGCCGTGCTGGAACGCGAAGCGACGAC
CGGAGCCGGTCATGATGCCCGCTTGGGCGAATTGCGGGAGCAGATTGCAGCCATCGAGTGCGATCTCGCG
ATCCGGAAGGCCCGTTTTGACGAAGAGCGGACGCTGGTGGAGGAGATCCTGGGCTTGCGGCGCGGTATGG
AAGACCCGATGGAGCAGGTCGGGGCGGATGTTGCCCATGCCGAGGACCCCAGGCGTGCCATCGGCCGGCG
CTCGGCGAAGGACGAGTTGGACGCACTGATGTCGCGATTGCGGGACATGCAGGGCGAGACGCCGATGGTC
CCCCTTCACGTGGACGGTCATGTAGTCGCGGAAATCGTGGCGGCATGGACGGGGATTCCCCTGGGCAAGA
TGGTGAAGGACGAAATTCGCACGGTGCTGAAGCTGAAACCGCTACTGCAGGAGCGGGTGATCGGACAGGA
CCATGCGTTGGAGGCGGTTGCTCAGCGCGTGCGGACAGCGCGCGCGAACCTCGAGGATCCGAACAAGCCC
AAAGGAGTCTTCATGTTCGTCGGGCCCTCGGGCGTCGGGAAGACCGAAACCGCGCTTGCCCTGGCCGATA
TTCTCTACGGGGGGGAGCGCAAGCTCGTGACCATCAACATGAGCGAATACCAGGAGGCGCACAGCGTATC
GGGGCTCAAGGGTTCGCCCCCCGGGTATGTCGGATACGGGGAAGGAGGCGTGCTGACGGAGGCCGTGCGG
CGCAATCCTTATAGCGTCGTACTGCTCGACGAGGTCGAAAAGGCGCATCCCGATGTATTGGAACTGTTCT
TCCAGGTTTTCGACAAGGGCGTGCTTGACGATGCCGAGGGCCGGGAGATCGATTTCCGCAACACCCTGAT
CATCCTGACGAGCAACGTTGGCTCAAGCCAGATCATGCAGGCGTGCCTGAACCGGTCTGGCGAGGAGATG
CCCTCGGCGGAAGACTTGGGAGCGTCGCTGCGGCCGGTGCTGTGCAAGGCGTTCAAGCCAGCCTTTCTCG
GGCGCATGCAGGTTGTGGCGTATTACCCGATTTCGGATGAGGTGCTGGCGCAAATTATCGTGCTCAAGCT
CGGCCGCATCCGCGACCGCATCGCGACGAATCACAAGGCGGCTTTCGTGTGGGACGAAAAGCTGGTGGGT
GCCGTTCTCGCGCGCTGCACTGAAGTCGACTCGGGGGCCCGCAATGTCGATCACATCCTAAATGGCACCC
TCTTGCCGGAGATTGCCGAAGCCGTTTTGGCACGCATGGCGGACGGTGCGCAGATCCAGAGGATCCGGGT
GACGGCCTTGAAGAGCGGCGAATTCCGTTATTCGATCAAATGA
 Primer design