SecReT6
Protein ID: 470463037
SecReT6 ID738
T6SS typei2
Gene symbol-
Locus tagETAC_09335
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2130320..2131612 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDM4TIP5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 1.30E-36, Aligned region: 111..150
DUF3702 [PF12486], Evalue: 1.30E-36, Aligned region: 286..426
ImpA-rel_N [PF06812], Evalue: 2.50E-20, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 2.50E-20, Aligned region: 334..351
Protein Sequence: 430 a.a.     [Download]
>gi|470463037|ref|YP_007629348.1| ImpA domain-containing protein [Edwardsiella tarda C07-087]
MNETSPRKIKTGGDPRTLPDYAALRDEMSKLTHPARPDVNWHYVEKRCLSLFEHNGVELQTAVWYTLART
QLAGLYGLNEGLAILDALISHQWGALWPQPIHTRMEILGGLSQRLQQLMRTLPLSYSDLSQLYQAEQLLS
RLGGVLQRLELKHLSQLDPLRAMIHNSAVRLENSDAASRADTAIQAGIVVPATVMSGMGASADILSGVGL
QERNEPGGSVKWVYVAQPRRQANVEVLAALPPPAKKWRFFIAGICSTLAIGAATAWGWQVINPNPLSPVP
VAAKGASLKTLEQMPALWRQEYGFALAARAVPAEAEKMREQWQRYISGNALPAESLSGWHQGMAGLTDLT
RRLNALDERKGKYLTGSELKSMVFTITQSFGRTIPVEERLYRLSQREKGAALPSAQILQEDIYFEQLLNR
YALIKQQAMR
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|470461182|ref|NC_020796.1|:c2131612-2130320 Edwardsiella tarda C07-087, complete genome
ATGAATGAGACCTCCCCCCGTAAAATTAAAACCGGCGGTGACCCGCGAACCCTGCCGGATTATGCCGCCC
TGCGCGATGAAATGAGCAAATTAACCCATCCGGCGCGCCCGGATGTGAACTGGCACTATGTCGAAAAGCG
TTGTCTCTCGCTGTTTGAACACAATGGCGTGGAGCTACAGACCGCGGTCTGGTACACGCTGGCCCGCACG
CAGCTGGCCGGGTTGTACGGACTCAATGAGGGGCTGGCGATTTTGGATGCCTTGATAAGCCATCAGTGGG
GCGCGCTCTGGCCGCAGCCGATACATACCCGCATGGAGATCCTCGGCGGTCTGAGCCAGCGTCTGCAGCA
GCTGATGCGTACGCTTCCGCTAAGCTACAGCGATCTCAGTCAGCTGTATCAGGCAGAGCAGCTGCTTAGC
CGTCTCGGGGGCGTGTTACAGCGTCTGGAGCTTAAGCACCTGAGCCAGCTTGATCCCCTGCGAGCGATGA
TACACAACAGTGCGGTCCGGCTGGAAAACAGCGACGCCGCATCCCGCGCCGATACCGCTATTCAGGCCGG
TATTGTCGTGCCAGCGACGGTCATGAGCGGCATGGGTGCCTCGGCTGATATCTTGTCCGGCGTCGGGCTT
CAAGAGCGCAATGAGCCCGGCGGTTCGGTCAAGTGGGTGTATGTCGCGCAGCCAAGGCGACAGGCGAATG
TGGAGGTGCTGGCGGCGCTACCGCCCCCGGCGAAAAAATGGCGGTTCTTCATCGCCGGCATCTGCTCGAC
GCTGGCGATAGGCGCGGCCACCGCGTGGGGCTGGCAGGTGATCAACCCGAATCCGCTCAGCCCGGTGCCC
GTTGCGGCAAAGGGCGCCTCGCTGAAGACGCTTGAGCAGATGCCCGCGCTGTGGCGACAGGAGTATGGCT
TTGCGCTGGCCGCGCGGGCGGTGCCCGCTGAGGCGGAGAAAATGCGGGAACAGTGGCAGCGCTATATCAG
TGGAAACGCCCTGCCCGCCGAGTCGCTTTCCGGCTGGCATCAGGGCATGGCGGGGTTAACGGATTTGACC
CGCCGCCTGAATGCCCTGGATGAGCGTAAAGGCAAATATCTGACCGGCTCAGAGTTGAAATCGATGGTCT
TTACCATAACGCAAAGCTTCGGGCGGACGATCCCCGTAGAGGAGCGTCTGTATCGATTAAGTCAGAGAGA
GAAGGGGGCGGCGCTGCCGTCTGCGCAGATATTGCAGGAGGATATCTATTTTGAGCAACTATTAAATCGC
TATGCGCTGATCAAGCAGCAGGCAATGCGCTGA
 Primer design