SecReT6
Protein ID: 470463038
SecReT6 ID738
T6SS typei2
Gene symbol-
Locus tagETAC_09340
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2132101..2132553 [-]
Producthypothetical protein
NoteTssE
UniProt IDM4TJA8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.60E-14, Aligned region: 30..116
Protein Sequence: 150 a.a.     [Download]
>gi|470463038|ref|YP_007629349.1| hypothetical protein ETAC_09340 [Edwardsiella tarda C07-087]
MSESPRPSLYETLFGNFTGGLDLNQVSEQNQVILSVLDSLRRIVNCRAGTLAHLPDYGLPDMTKILQGMP
GSAHELMGTLSAVLLKYEPRLKKIAVVLLEPSVPGELRYAIDAELKGVGLVRYGTEFTPEGRVLLRHLKQ
QQYLDNSASA
 
Nucleotide Sequence: 453 bp     [Download]
>gi|470461182|ref|NC_020796.1|:c2132553-2132101 Edwardsiella tarda C07-087, complete genome
ATGAGTGAGTCACCACGCCCGTCGCTGTATGAAACGCTCTTTGGCAACTTTACCGGCGGCCTCGACCTGA
ATCAGGTCAGTGAACAGAATCAGGTCATTCTCTCCGTACTCGACAGCCTGCGGCGCATTGTTAACTGTCG
CGCCGGGACGCTAGCGCATCTGCCGGACTACGGCCTGCCGGATATGACTAAAATTCTCCAGGGGATGCCG
GGGTCGGCCCATGAACTGATGGGCACCCTGTCGGCTGTTCTGCTCAAATATGAGCCCCGTCTGAAAAAAA
TAGCCGTTGTCCTGCTGGAACCGAGCGTCCCCGGCGAGCTGCGCTATGCCATTGATGCCGAGCTCAAGGG
CGTTGGCCTGGTGCGCTATGGCACCGAGTTTACGCCCGAAGGCCGAGTGCTGTTGCGACACCTCAAACAG
CAGCAGTATCTCGATAATAGCGCCAGCGCATGA
 Primer design