SecReT6
Protein ID: 470463039
SecReT6 ID738
T6SS typei2
Gene symbol-
Locus tagETAC_09345
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2132546..2133088 [-]
Producthypothetical protein
NoteTssJ
UniProt IDM4U0J4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.60E-36, Aligned region: 21..171
Protein Sequence: 180 a.a.     [Download]
>gi|470463039|ref|YP_007629350.1| hypothetical protein ETAC_09345 [Edwardsiella tarda C07-087]
MKMAITADKLTLAALAAGITLVLAGCGLTQRVTDGTVAVTKSIFYKQIKTLHLDIRAREAVNSNAGGVAL
STVVRIYQLKGRKTFDSTDYPSLFNDDGQAIKADRVAENAIRLQPGGAVMIDMPMAENAQYVAVAGMFMS
PDQENNTWRVVLSRDDLDPDHARVIEAGNNRLTLKALKDE
 
Nucleotide Sequence: 543 bp     [Download]
>gi|470461182|ref|NC_020796.1|:c2133088-2132546 Edwardsiella tarda C07-087, complete genome
ATGAAGATGGCGATTACCGCGGATAAATTGACTCTGGCTGCGCTGGCCGCCGGTATCACACTGGTACTGG
CGGGCTGTGGGCTGACCCAACGCGTCACGGACGGCACCGTCGCGGTGACCAAATCGATTTTTTATAAGCA
GATAAAGACCCTGCATCTGGATATTCGCGCCCGTGAAGCCGTCAACAGCAATGCTGGTGGTGTAGCGCTG
TCGACGGTGGTGCGGATCTACCAGCTTAAGGGCCGTAAAACGTTCGACAGTACGGACTACCCGTCACTGT
TTAACGATGACGGCCAGGCCATCAAAGCGGACCGAGTGGCAGAGAACGCTATCCGCCTGCAGCCGGGTGG
GGCGGTGATGATCGATATGCCGATGGCGGAAAACGCGCAGTACGTGGCGGTGGCGGGGATGTTTATGTCG
CCTGACCAGGAGAACAACACCTGGCGGGTGGTGCTGAGCCGTGACGACCTCGATCCGGACCACGCCCGGG
TGATTGAGGCTGGCAACAACCGTCTGACCCTGAAGGCGCTGAAAGATGAGTGA
 Primer design