SecReT6
Protein ID: 470463040
SecReT6 ID738
T6SS typei2
Gene symbol-
Locus tagETAC_09350
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2133063..2134157 [-]
Producthypothetical protein
NoteTssG
UniProt IDM4TL21
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-78, Aligned region: 22..323
Protein Sequence: 364 a.a.     [Download]
>gi|470463040|ref|YP_007629351.1| hypothetical protein ETAC_09350 [Edwardsiella tarda C07-087]
MERKPQPAPAQLIAQLGDRLPYLNFYRFCQLLEQSQPDKPLIGSTWQVRHEPVRFRPHPGMGFPAAEIKG
VELPEYPHLPPTVRITFMGLYGVESPLPMHCIDDITQRREGYEATADFLDIFNHRLIAQYYRIWRKYSYP
ASFAAGGKDNISQYLLGLAGLGLDGCSESIAAPASRFLALLPLMLLPGRTAEGLASLVRLLAPNTQAKVW
HHDKRRVPLKTPLTMSVSQPIALINRPVMGRYATDVNSQVLMRLTTPDPTEVQGWLPGGALHSDLMALLH
VYLGARLDVRLQLCVDLSLLPDATMSTKPEAGAVQLGRTAVMRPLKAANTATQSKTITINLGRYERVQEN
IHRRETDEDGDYRG
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|470461182|ref|NC_020796.1|:c2134157-2133063 Edwardsiella tarda C07-087, complete genome
GTGGAAAGAAAACCACAGCCCGCGCCTGCCCAGCTGATAGCGCAGCTGGGCGACCGGCTGCCATACCTGA
ATTTTTACCGATTCTGCCAGTTACTGGAGCAGAGCCAGCCGGATAAGCCGCTCATCGGCAGCACCTGGCA
GGTTCGGCACGAGCCGGTGCGCTTCCGGCCTCATCCGGGGATGGGGTTCCCGGCCGCTGAAATCAAAGGC
GTAGAGCTGCCGGAGTATCCGCACCTGCCGCCGACGGTACGCATCACCTTTATGGGACTCTACGGCGTGG
AGTCCCCGCTACCGATGCACTGTATCGATGATATCACCCAGCGGCGGGAAGGGTATGAAGCGACAGCCGA
TTTTCTCGATATCTTCAACCACCGGTTGATTGCCCAGTATTACCGAATCTGGCGGAAATACTCTTACCCG
GCGAGCTTCGCCGCCGGCGGTAAGGACAATATCTCGCAGTACCTGCTGGGGTTGGCGGGACTGGGGCTAG
ATGGCTGCAGTGAAAGCATCGCGGCCCCGGCCTCACGTTTTTTGGCGCTGTTGCCGCTCATGTTGCTACC
GGGACGTACCGCAGAAGGTCTAGCCTCACTGGTGCGTCTGCTGGCACCCAACACGCAGGCGAAAGTCTGG
CACCACGATAAACGTCGGGTGCCGCTGAAGACGCCCCTGACCATGAGCGTCAGTCAGCCGATCGCCCTGA
TAAACCGCCCGGTGATGGGGCGCTATGCCACCGACGTGAACAGTCAGGTGCTGATGAGGCTCACGACCCC
TGACCCGACGGAAGTGCAGGGCTGGTTACCGGGCGGGGCGCTTCACTCGGATTTAATGGCGCTGCTGCAC
GTCTATCTTGGGGCTCGGCTGGATGTGCGCCTGCAGCTGTGCGTCGACCTTAGCCTACTGCCGGACGCGA
CAATGAGCACTAAACCTGAGGCTGGCGCAGTGCAGCTGGGGCGTACCGCTGTGATGCGGCCGCTGAAGGC
GGCGAACACGGCCACACAGTCCAAAACCATAACCATCAATCTTGGCCGCTATGAGCGGGTACAGGAAAAT
ATTCACCGCAGGGAGACCGATGAAGATGGCGATTACCGCGGATAA
 Primer design