SecReT6
Protein ID: 470463041
SecReT6 ID738
T6SS typei2
Gene symbol-
Locus tagETAC_09355
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2134121..2135884 [-]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDM4TMJ6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.00E-182, Aligned region: 6..582
Protein Sequence: 587 a.a.     [Download]
>gi|470463041|ref|YP_007629352.1| type VI secretion system protein ImpG [Edwardsiella tarda C07-087]
MKDLTLRYFDAEMRYLREAAKEFAQTHPDRAAMLDLDKAGTPDPYVERLFEGFAFSMGRLREKIDDDLPE
LTEGLVSMLWPHYLRTIPSLSVVALTPSLHAMKMAEVVPAGLEVYSRPVGPKNTVCRYRTTRDVMLNPLS
ITGVTMATEPDGRSLLQMRFACSRQADWSSADLRRLSLYLGADAPVSSQLHLMLTKRQAALYMRLPGQSD
RIRLDGYFSPGGFAEEEGLWPKGDTAFSGYQLLLEYFTFRDKFMFVHLNGLDGITPPVGAEYFDIEVVFS
TQWPSELPVTDDAIRLHCVPVINLFTLEADPLTITGLESEYLLRPKRLQDGHTEIYSVDSVTGSNRTHDA
EYVPFSSFRHKGGMMRRHAPPRYYHTRVKRGVTGLYDTWLILGGHQWEDDRQFEREAVSLQITGTNGQLP
RRALQSTLLDRCEQVVQTPLSVKNLGKPTLPVYPPAEDRFHWRVLSHLGSGFLNMMSTADVLRGTLALYN
WQEDELNTRRLEAIQQVAHHRLQRFEQGFLLRGLDIEVTLDSNGFTGEGDIHLFGEMLNRFFALYADMNQ
FNQLTLIVQPEGKCIRWKENHSPRLPS
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|470461182|ref|NC_020796.1|:c2135884-2134121 Edwardsiella tarda C07-087, complete genome
ATGAAAGATTTAACCCTGCGCTATTTCGATGCGGAAATGCGCTATCTCCGCGAGGCGGCAAAAGAGTTTG
CTCAGACCCACCCCGATCGGGCCGCGATGCTGGATCTGGATAAGGCTGGCACACCCGATCCCTACGTTGA
ACGCCTGTTCGAAGGCTTTGCCTTCTCGATGGGGCGGCTGCGCGAAAAGATTGATGACGACCTGCCGGAA
CTGACCGAAGGGCTGGTCAGTATGCTCTGGCCACACTACCTGCGCACCATTCCGTCCCTCTCGGTGGTGG
CGCTGACCCCCTCGCTCCATGCCATGAAAATGGCGGAGGTCGTGCCAGCGGGCCTTGAGGTGTACTCCCG
TCCGGTGGGGCCGAAGAACACGGTCTGCCGTTACCGCACCACCCGTGATGTGATGCTCAACCCGCTGAGC
ATCACAGGGGTGACCATGGCCACGGAGCCTGACGGGCGTTCGTTGTTGCAGATGCGCTTTGCCTGCAGCC
GCCAGGCGGACTGGTCCAGCGCTGATCTCCGCCGCCTAAGCCTGTATCTCGGCGCGGATGCGCCCGTCAG
CAGCCAGCTGCATCTGATGCTGACCAAACGGCAGGCCGCCCTGTATATGCGCCTGCCCGGGCAGAGCGAC
CGTATCCGGCTTGACGGGTACTTCTCGCCGGGCGGTTTTGCCGAAGAGGAGGGGCTGTGGCCGAAAGGCG
ATACCGCCTTCAGCGGCTATCAGCTGTTGTTAGAGTACTTCACCTTCCGCGATAAGTTTATGTTCGTCCA
TCTCAACGGCCTGGACGGCATTACACCGCCTGTTGGAGCGGAGTATTTCGATATCGAAGTCGTGTTCAGC
ACACAGTGGCCATCAGAGCTGCCGGTCACCGATGACGCCATCCGCCTCCACTGCGTGCCGGTCATCAACC
TGTTTACGCTGGAAGCCGACCCACTCACCATCACCGGGCTAGAAAGTGAGTACCTGTTGCGCCCTAAACG
CCTTCAGGACGGGCATACCGAGATTTATTCGGTGGATTCGGTGACCGGCTCAAACCGGACCCATGACGCG
GAGTATGTACCGTTCAGCAGTTTCCGCCACAAGGGCGGGATGATGCGCCGCCATGCCCCGCCACGCTATT
ACCACACCCGAGTAAAGCGCGGCGTCACCGGGCTGTATGACACCTGGCTGATTCTTGGTGGCCACCAATG
GGAAGATGACCGCCAGTTTGAGCGCGAGGCCGTGTCGCTGCAAATCACCGGCACCAACGGCCAGCTGCCG
CGCCGGGCGCTGCAGAGTACGCTGCTGGACCGCTGTGAGCAGGTGGTCCAGACGCCGCTGTCGGTGAAAA
ACCTCGGCAAACCCACGCTGCCGGTTTACCCGCCGGCGGAGGACCGTTTCCACTGGCGGGTACTGAGCCA
CTTGGGATCGGGGTTTCTGAACATGATGAGCACCGCCGACGTGCTGCGCGGCACGCTGGCGCTCTATAAC
TGGCAGGAGGATGAGCTGAATACCCGCCGTTTAGAGGCGATTCAGCAGGTGGCTCATCATCGGCTACAGC
GCTTTGAACAGGGTTTTCTGCTGCGGGGGCTGGATATCGAGGTCACCCTCGATAGCAACGGCTTCACCGG
CGAGGGGGATATTCACCTGTTCGGAGAAATGCTCAACCGGTTCTTCGCGCTGTATGCCGACATGAACCAG
TTTAACCAGCTCACGCTTATCGTTCAGCCAGAAGGAAAATGCATCCGGTGGAAAGAAAACCACAGCCCGC
GCCTGCCCAGCTGA
 Primer design