SecReT6
Protein ID: 470463043
SecReT6 ID738
T6SS typei2
Gene symbol-
Locus tagETAC_09365
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2136766..2138361 [-]
Producttype VI secretion system protein VasJ
NoteTssA
UniProt IDM4TJB2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.90E-22, Aligned region: 66..127
ImpA-rel_N [PF06812], Evalue: 3.90E-22, Aligned region: 163..182
Protein Sequence: 531 a.a.     [Download]
>gi|470463043|ref|YP_007629354.1| type VI secretion system protein VasJ [Edwardsiella tarda C07-087]
MSTLNALLQACQAEPASLLAATRERVAQWDNWLQPLPGSSPVGDDPSYDDDFQRMREEVNKLSGADTDLI
CRLAEKLLTTLAKDIRVATYYCWAKLHREGEKGLAEGFELLAGLIDRFGAQLHPQRDRSRKAALEWLAGS
RMADSLSLYPEVVRNDAMRTSGALLLIAQLTEHEPDQTRPELNALYGALENRLQKAGGVDAVVPQNAGSS
ETPSAAGHRDAPAIGRITSGQDLLAQARTLTEYLREQPDGWLPAHHLMKSLRHDTLRVIPAPDAQGRTRI
EPPRADQRALLKRLYLQQNWAEMLETADSTFSRGANHLWLDLQWYIHQALTKSGQETLADIVAADLKGLL
SRLSGLETLAFSDGTPFADDVTLNWIQQRVLDTVGGWGDDTPSAPVTPGNDDILALEPEAVALADSEGPD
AALAWLQRRPGVTTARQQWLLRLLMGRIAEQYGKNELAVHLFAELGERAREVTLSNWEPELLFEVQARHL
KLLRLKAARSEADKVRLNPLMEQLLAGLIAVDPVRASVLCA
 
Nucleotide Sequence: 1596 bp     [Download]
>gi|470461182|ref|NC_020796.1|:c2138361-2136766 Edwardsiella tarda C07-087, complete genome
ATGAGTACGCTGAATGCGTTATTGCAGGCCTGCCAGGCTGAGCCTGCATCACTGCTTGCCGCGACCCGTG
AGCGCGTGGCGCAGTGGGATAACTGGCTGCAGCCGTTGCCCGGCTCATCCCCCGTCGGTGACGATCCGAG
CTATGACGATGACTTCCAGCGGATGCGCGAGGAGGTCAATAAACTCTCCGGGGCAGACACGGATCTTATC
TGCCGGCTGGCAGAGAAGCTGCTCACCACCCTCGCCAAAGATATCCGTGTTGCCACCTACTACTGCTGGG
CAAAGCTGCACCGCGAAGGCGAGAAGGGATTGGCCGAGGGCTTTGAATTGTTGGCCGGTCTGATAGACCG
CTTCGGCGCGCAGCTGCATCCGCAGCGTGACCGCAGCCGTAAGGCGGCGCTGGAGTGGCTGGCCGGCTCG
CGTATGGCTGATTCACTTTCCCTGTATCCGGAAGTGGTCAGGAACGATGCGATGCGGACCAGCGGGGCGC
TGCTGCTGATAGCGCAGCTTACCGAACATGAACCGGATCAAACCCGCCCGGAACTCAATGCGCTGTACGG
TGCACTGGAAAACCGTCTGCAGAAAGCGGGCGGGGTGGATGCGGTGGTGCCGCAGAACGCCGGTAGCAGC
GAAACACCCTCAGCGGCCGGCCACCGCGATGCCCCGGCCATCGGGCGCATCACCTCCGGTCAGGATTTGC
TGGCACAGGCCCGCACCCTCACCGAATACCTGCGCGAGCAGCCCGATGGCTGGCTGCCGGCACACCATCT
GATGAAAAGTCTGCGTCACGATACCCTGCGGGTCATTCCGGCCCCCGATGCCCAGGGCCGTACTCGCATC
GAACCCCCCAGAGCGGACCAGCGTGCATTGCTCAAACGCCTCTATCTGCAACAGAACTGGGCTGAAATGC
TGGAAACGGCTGACAGCACCTTTTCCCGCGGTGCCAACCACCTGTGGCTGGATTTGCAGTGGTATATCCA
CCAGGCGCTGACGAAATCCGGCCAAGAGACGCTGGCCGACATTGTCGCGGCTGACCTGAAAGGGCTGCTG
TCGCGCCTGTCCGGGCTGGAGACGCTGGCGTTCAGTGACGGTACCCCGTTTGCGGACGACGTGACGCTGA
ACTGGATCCAGCAGCGCGTGCTGGACACCGTCGGTGGGTGGGGTGATGACACGCCATCAGCCCCGGTTAC
CCCTGGTAACGACGACATTCTGGCGCTGGAGCCGGAAGCGGTGGCACTGGCCGACAGTGAAGGCCCGGAT
GCCGCGTTGGCCTGGTTACAGCGGCGTCCCGGTGTCACCACGGCGCGGCAACAGTGGCTGCTGCGCCTGC
TAATGGGCCGCATTGCCGAACAGTACGGTAAAAATGAGCTGGCGGTGCACCTGTTTGCAGAGCTGGGTGA
GCGTGCAAGAGAAGTGACCCTTAGCAACTGGGAGCCTGAGCTGCTGTTCGAGGTCCAGGCCCGTCATCTG
AAACTCCTGCGCTTGAAAGCCGCTCGCAGTGAGGCTGACAAGGTGCGCCTGAATCCACTGATGGAACAGT
TGCTGGCTGGACTGATTGCGGTTGATCCGGTTCGTGCTTCTGTCTTGTGCGCGTAA
 Primer design