SecReT6
Protein ID: 470463044
SecReT6 ID738
T6SS typei2
Gene symbol-
Locus tagETAC_09370
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2138361..2141612 [-]
Producthypothetical protein
NoteTssM
UniProt IDM4U0J8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.60E-69, Aligned region: 109..143
IcmF-related [PF06761], Evalue: 2.60E-69, Aligned region: 326..360
IcmF-related [PF06761], Evalue: 2.60E-69, Aligned region: 362..681
IcmF-related [PF06761], Evalue: 2.60E-69, Aligned region: 734..830
DUF1215 [PF06744], Evalue: 4.60E-35, Aligned region: 350..387
DUF1215 [PF06744], Evalue: 4.60E-35, Aligned region: 577..594
DUF1215 [PF06744], Evalue: 4.60E-35, Aligned region: 801..920
Protein Sequence: 1083 a.a.     [Download]
>gi|470463044|ref|YP_007629355.1| hypothetical protein ETAC_09370 [Edwardsiella tarda C07-087]
MFRHGKTITLAIKQGWHRFQAKRLSVLPADEGRVKQTAPRNVTVDTIRDAMRNLYGRRWGRKTRILLITG
TAAEVEQLTPGLTSQLWQEDRGTLLLWGGDLNIPADSVWLSALRKLRRRPVDGLVWVTSAFDQLSAPGLE
QPLPLPSESTMDSLSHAISVRMETLGWQLPLYVWSLHPRAGKPEGRIVQASGCLLPAGCTPEGLAEQLAA
LTPDLTSQGLQQSCGEVKHNFLLTLADQLIREPESVTAPLSVMLNPYRPLPLAGVVFSQPSAGADRAVPH
HWGMDKRWEALPEAVRMLPAGLRPRKPGMPWRNLFASVIALAMVGWAAWMSIAYVTNRSQIDGANAQAEL
AARQNQPLQQRLHALLELQKTLARLQYRAEHGVPWYEQAGLSQNDALLAALWPRYQDSALPLLRDTAADH
LQKQLNIFNALPPSSPLREQRAKTTYGQLRLYLMLARPAHMDAAWFSAALLNDWPKRDGVRDGVWQGMAP
SLLSFYGAQLVAHPEWRIRADERMVSQVRSLLVRLMGVRNSESSLYQTMLSEVAHLYVDMRLDDMTGDTD
ASRLFSTTNIVPGMFTRQAWEQAVQPAIEKVVKARRDELDWVLTDNTRQAKMQDEASPDALKRRLTARYF
ADFGGAWLAFLNSLRWNRTATLSDAIDQLTLMADVRQSPLVALMNTLNVQGRAGQTGEAISDSLVKSAKN
LLGGDSKKAIDQNAGVHGPLDATFGPLLALMDKNRTGTQEQSLQSYLTRVTQVRLRLQQVTNAADPQAMA
QTMAQTVFQGKAVDLTETRDYGSLIAAGLGQEWSGFGRTVFVNPMERAWQQVLTPAAESLNAQWQQAVVA
EWNRAFGGRYPFNHSSSDVSLPLLAKYLNADSGRIAQFLQTRLKGVLHQEGNHWVPDSINAQGLAFNPAF
LNAINTLSYISDVAFPEGNAGMSFELRPGTAAGVMQTDLIIDSQTLTYVNQLPAWKRFTWPADTEAPGAH
LSWISTQAGTRQYADIPGAWGWVRLLEKAAVEAYPGLGSGYSLSWRAQDGRMLNYTLRTDAGEGPLALLK
LRNFRLPETIFSTTGVAAPDPLAGATRGAEEVY
 
Nucleotide Sequence: 3252 bp     [Download]
>gi|470461182|ref|NC_020796.1|:c2141612-2138361 Edwardsiella tarda C07-087, complete genome
ATGTTCCGCCACGGCAAAACCATCACGCTCGCCATCAAACAGGGCTGGCATCGTTTTCAGGCAAAGCGTC
TAAGTGTCCTGCCTGCCGATGAAGGCCGCGTCAAGCAGACCGCACCCCGCAACGTCACCGTCGACACCAT
CCGTGACGCCATGCGTAATCTCTATGGTCGTCGCTGGGGACGTAAAACACGCATCCTGCTGATAACCGGT
ACGGCCGCTGAAGTGGAGCAACTGACTCCCGGCCTTACCAGCCAGCTCTGGCAGGAAGACCGCGGCACGT
TGTTGCTGTGGGGCGGTGATCTCAATATCCCGGCCGACAGCGTCTGGCTAAGCGCGCTGCGCAAATTGCG
TCGTCGCCCGGTGGATGGACTGGTGTGGGTCACCTCGGCGTTTGACCAGCTTTCAGCGCCGGGGCTGGAA
CAGCCGCTGCCGCTGCCGTCGGAAAGCACCATGGATTCCCTCTCTCATGCCATCAGCGTCCGTATGGAAA
CGCTTGGCTGGCAGCTCCCGCTGTATGTTTGGTCCCTGCACCCGCGCGCTGGTAAGCCGGAGGGGCGCAT
TGTGCAGGCCTCGGGCTGTCTGCTGCCTGCCGGATGCACTCCTGAAGGGTTGGCTGAACAGCTTGCGGCA
CTGACGCCAGATTTGACTTCACAGGGTCTGCAGCAGAGCTGTGGTGAGGTAAAACACAACTTCCTGCTGA
CGCTTGCCGATCAGCTCATTCGTGAGCCGGAAAGCGTGACCGCGCCGCTGTCGGTGATGCTCAATCCGTA
CCGTCCGCTGCCGCTGGCCGGGGTGGTGTTCAGTCAGCCTTCAGCCGGCGCCGACCGTGCCGTGCCGCAC
CACTGGGGCATGGATAAGCGCTGGGAGGCTCTGCCTGAAGCGGTACGGATGCTCCCTGCCGGACTGCGTC
CGCGCAAGCCGGGCATGCCCTGGCGTAACCTGTTTGCGTCGGTTATCGCCCTGGCGATGGTGGGCTGGGC
TGCATGGATGAGCATCGCGTATGTCACCAACCGCAGCCAGATTGACGGTGCAAATGCTCAGGCCGAACTT
GCCGCCCGCCAGAATCAGCCGCTCCAACAGCGCCTGCACGCGCTGTTGGAGCTGCAGAAAACGCTGGCCC
GTCTGCAGTACCGCGCTGAGCATGGGGTGCCATGGTATGAGCAGGCCGGGCTGAGCCAGAATGACGCCCT
GCTGGCGGCGCTCTGGCCACGTTATCAGGACAGCGCGCTGCCTTTGCTGCGCGATACGGCCGCTGACCAT
TTGCAGAAACAGCTAAATATCTTTAATGCCCTGCCGCCGAGCAGCCCACTGCGCGAGCAGAGGGCAAAAA
CCACCTATGGCCAGCTTAGGCTCTACCTGATGCTGGCGCGTCCAGCGCATATGGACGCAGCCTGGTTCAG
CGCTGCCTTGCTGAACGACTGGCCAAAGCGTGATGGCGTGAGAGACGGCGTCTGGCAGGGGATGGCACCG
TCGCTGCTGTCGTTCTATGGCGCGCAGCTGGTCGCGCACCCAGAGTGGAGGATTCGAGCGGATGAGCGCA
TGGTCAGTCAAGTACGCTCTCTGCTGGTGCGCCTGATGGGCGTGCGTAATAGCGAATCGTCCCTTTATCA
GACGATGCTCTCTGAGGTAGCCCATCTGTATGTCGACATGCGCCTTGACGATATGACCGGCGATACCGAC
GCATCCCGTTTGTTCAGCACCACCAACATCGTACCGGGAATGTTTACCCGTCAGGCCTGGGAGCAGGCGG
TGCAGCCTGCCATTGAGAAGGTGGTGAAGGCGCGACGGGACGAGCTGGACTGGGTGCTTACGGACAACAC
TCGTCAGGCAAAAATGCAGGACGAAGCCTCGCCGGATGCGCTGAAAAGGCGCCTGACGGCGCGTTATTTT
GCCGATTTTGGCGGAGCTTGGCTGGCGTTTCTCAACAGCCTGCGCTGGAACCGGACAGCCACGCTGTCGG
ATGCCATTGATCAACTGACCCTGATGGCCGACGTGCGCCAGTCGCCGCTAGTGGCGCTGATGAATACCCT
GAACGTTCAGGGACGCGCTGGGCAGACTGGCGAGGCGATTTCCGACTCCCTGGTGAAATCAGCCAAAAAC
CTGCTCGGTGGTGACAGCAAGAAGGCCATAGACCAGAATGCCGGCGTTCATGGCCCGCTGGATGCCACCT
TTGGCCCGCTGCTGGCGCTGATGGACAAGAACCGCACGGGGACACAGGAGCAGAGCCTGCAGTCGTACTT
GACCCGGGTGACCCAGGTACGTCTGCGCCTGCAGCAGGTGACCAACGCCGCCGACCCGCAGGCGATGGCC
CAGACCATGGCCCAGACGGTCTTCCAGGGCAAGGCGGTGGATCTGACCGAAACCCGTGACTACGGCAGCC
TGATTGCCGCGGGTCTGGGTCAGGAGTGGAGTGGCTTTGGGCGTACGGTGTTTGTGAACCCGATGGAGCG
GGCCTGGCAACAGGTGCTGACCCCGGCGGCCGAAAGCCTCAATGCCCAGTGGCAGCAGGCGGTGGTGGCC
GAGTGGAACCGTGCCTTTGGAGGACGCTATCCGTTTAACCACTCCAGCAGTGACGTGTCCCTGCCGTTGC
TGGCCAAATACCTCAATGCCGACTCCGGGCGTATTGCGCAGTTCCTGCAGACCCGTCTTAAGGGCGTACT
GCACCAAGAGGGCAACCACTGGGTGCCGGACAGCATCAACGCGCAGGGGCTCGCGTTCAACCCGGCGTTC
CTCAATGCCATCAATACCCTGAGTTATATCTCGGACGTGGCCTTCCCCGAAGGCAACGCCGGCATGAGCT
TCGAACTGCGCCCAGGCACCGCCGCGGGCGTGATGCAGACCGACCTGATTATCGATAGCCAGACGTTGAC
CTATGTGAACCAGCTGCCGGCGTGGAAGCGTTTCACCTGGCCTGCGGATACGGAGGCGCCCGGCGCGCAC
CTGAGCTGGATTAGCACGCAGGCGGGCACCCGTCAGTATGCGGACATTCCCGGCGCCTGGGGCTGGGTAC
GCCTGCTTGAGAAGGCGGCGGTGGAGGCTTACCCGGGGCTCGGCAGCGGTTACAGCCTGAGCTGGAGGGC
ACAGGACGGGCGCATGCTCAATTACACCCTGCGTACCGATGCCGGAGAAGGGCCGCTGGCGCTGCTGAAG
CTGCGCAATTTCCGCCTGCCTGAGACCATCTTCAGCACTACCGGCGTGGCGGCGCCAGATCCGCTCGCCG
GCGCAACCCGTGGTGCCGAGGAGGTCTACTGA
 Primer design