SecReT6
Protein ID: 470463046
SecReT6 ID738
T6SS typei2
Gene symbol-
Locus tagETAC_09380
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2142925..2143191 [-]
Producthypothetical protein
NotePAAR
UniProt IDM4TMJ9
KEGG IDetc:ETAC_09380
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 4.10E-24, Aligned region: 9..81
Protein Sequence: 88 a.a.     [Download]
>gi|470463046|ref|YP_007629357.1| hypothetical protein ETAC_09380 [Edwardsiella tarda C07-087]
MSKGFVLLGDQTTHGGQVLSASSTMIVNGKKVALIGDKVSCPKEGHGVNTIIEGSPEWSSDGKAIAVDGC
RCECGCQLISSAPDCVVG
 
Nucleotide Sequence: 267 bp     [Download]
>gi|470461182|ref|NC_020796.1|:c2143191-2142925 Edwardsiella tarda C07-087, complete genome
ATGTCCAAAGGATTCGTATTACTCGGTGATCAAACTACCCATGGGGGGCAGGTGCTTTCAGCATCCTCGA
CCATGATTGTTAATGGTAAAAAGGTTGCTCTGATCGGAGATAAAGTTAGCTGTCCGAAAGAAGGGCATGG
TGTTAATACCATTATTGAAGGTTCGCCTGAATGGTCTTCAGACGGTAAAGCGATTGCTGTGGATGGTTGC
CGCTGTGAATGTGGTTGTCAGCTGATATCCAGCGCACCGGATTGTGTTGTAGGATAA
 Primer design