SecReT6
Protein ID: 470463050
SecReT6 ID738
T6SS typei2
Gene symbol-
Locus tagETAC_09400
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2147849..2150365 [-]
Producthypothetical protein
NoteTssI
UniProt IDM4TL30
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-59, Aligned region: 42..363
Phage_GPD [PF05954], Evalue: 1.40E-59, Aligned region: 404..449
Phage_GPD [PF05954], Evalue: 1.40E-59, Aligned region: 765..815
DUF2345 [PF10106], Evalue: 1.10E-48, Aligned region: 616..767
T6SS_Vgr [PF13296], Evalue: 3.40E-32, Aligned region: 495..601
Phage_base_V [PF04717], Evalue: 2.20E-15, Aligned region: 408..488
Protein Sequence: 838 a.a.     [Download]
>gi|470463050|ref|YP_007629361.1| hypothetical protein ETAC_09400 [Edwardsiella tarda C07-087]
MSLTDTLKNPLSALTEGGLNRYRLDIPSCTASLDVEEFNGKEFMSELYYYEVIFTSSDQNISSAQLLTKP
ATLTMGTGPLMGLTGQKVVHGVVTHFKRISGSRDQATYQIIIEPFLSLLRKQFRTHRFFVNKSVPEVVAE
VLMEHGLKGWEYEFTLKADYPKREQINQYKENDLAFIERLLAEVGIFYFFTLQPDTQTEVVHFADKQSAW
TFGKKLPLSSPSGMSDNGVDSVWDVHVRQSVVERSVTASDYNHREAQNVLTSVPADMTRGDGDGVTYGEV
YHYLPRHLERGDKITPTAETGNFWARLEHERFLSTQTTVTGSSTDHTLGPAQVVTITDMAIPPTLPRETE
NGVVIIRTGYYASRKNALKVAWVAMPYYENRCWRPAAKKRPVVSGTLTARVTSAKDNDIYAWQDASGMYR
VKFDADRDDKRQGMESMPVRFAKPYGGDKYGFHFPLIQGTEVAIAFHEGDPDRPYIAHAMHDSRHVDHVT
EANSTRNVIRTAGLNKLRMEDKRGEEHVKLSTEYGGKTQLNLGHNVDAAREPRGEGAELRTDRYVSIRGG
AGVFITADKQPFASDKMLSMREAISQLENALSIARSLSDAAETADALPADIQSQVNLTDALKDLVQPGMV
LNAPEGVSITSPQAVRMASGSASVGIMSQQNTDISALKRFTVAAGEAVSMLARKAGMKLFAAKGKVEIQA
QDDAIEAIAKKDVTVTSVEGKVVITGATELVVNCDGAFIKLAGGDMEFGAPGNILLKCANVQKMGSADYD
APKPELPQGYSENFIAQDKESGDILANTRYRITTADGSVYEGRTDSEGKTAEIFGVAKSKINIELLGG
 
Nucleotide Sequence: 2517 bp     [Download]
>gi|470461182|ref|NC_020796.1|:c2150365-2147849 Edwardsiella tarda C07-087, complete genome
ATGAGTCTGACAGATACGCTTAAGAACCCCCTGTCTGCGCTAACTGAAGGCGGACTTAATCGCTACCGTC
TAGATATTCCGTCCTGCACAGCCTCACTGGATGTGGAAGAGTTTAACGGTAAGGAGTTCATGAGTGAGCT
CTACTACTACGAAGTTATCTTTACCAGCAGCGATCAGAATATCAGTTCAGCGCAGTTGTTGACTAAGCCT
GCCACGCTGACTATGGGAACCGGGCCACTGATGGGGCTGACCGGGCAGAAAGTGGTGCATGGCGTGGTGA
CGCATTTTAAGCGTATCAGTGGCTCTCGTGACCAGGCGACGTACCAGATTATTATTGAGCCGTTCCTGTC
TTTGCTGCGCAAGCAATTCCGAACTCACCGCTTTTTTGTCAATAAGTCGGTCCCGGAAGTGGTGGCAGAG
GTGCTCATGGAGCATGGGCTCAAAGGCTGGGAGTATGAGTTCACCCTCAAAGCCGACTATCCAAAGCGTG
AACAGATTAACCAGTACAAGGAAAATGACCTCGCGTTTATTGAACGCCTGCTGGCCGAAGTGGGGATTTT
CTATTTCTTTACCCTGCAGCCCGACACCCAGACCGAAGTGGTGCATTTCGCGGATAAACAGAGCGCATGG
ACGTTCGGTAAAAAACTGCCGCTCAGCAGCCCATCGGGAATGAGTGACAATGGGGTCGACTCGGTGTGGG
ATGTGCACGTCCGACAGAGCGTGGTGGAGCGCTCTGTCACCGCCAGTGATTACAATCACCGTGAAGCCCA
GAATGTCCTGACCTCGGTACCGGCGGACATGACCCGCGGCGACGGTGACGGTGTTACCTACGGTGAGGTC
TATCACTACCTGCCACGTCATCTTGAGCGTGGCGACAAAATCACGCCGACGGCGGAAACCGGTAACTTCT
GGGCGCGTCTGGAGCATGAACGTTTCCTGTCTACCCAGACCACGGTGACTGGCAGCAGCACCGACCACAC
CCTCGGCCCGGCGCAGGTAGTGACTATTACCGACATGGCTATCCCGCCAACACTGCCCCGGGAAACGGAG
AACGGTGTTGTTATCATCCGCACTGGTTACTACGCCAGCCGTAAGAATGCCCTGAAAGTGGCATGGGTAG
CGATGCCGTACTACGAGAACCGCTGCTGGCGTCCTGCCGCTAAAAAGCGCCCAGTGGTCAGCGGCACCCT
GACGGCGCGCGTAACCAGCGCCAAAGATAACGATATCTATGCCTGGCAGGATGCCTCCGGCATGTACCGG
GTGAAGTTTGATGCAGACCGCGATGATAAACGCCAGGGCATGGAAAGTATGCCGGTGCGCTTTGCCAAGC
CTTACGGCGGTGATAAATACGGCTTCCACTTCCCGCTGATACAGGGCACTGAGGTCGCGATTGCGTTCCA
TGAAGGCGACCCCGATCGTCCGTATATCGCCCATGCGATGCACGACTCCCGCCACGTTGACCACGTCACT
GAGGCCAACAGCACGCGTAACGTTATCCGCACCGCTGGCCTGAACAAGCTGCGGATGGAGGACAAGCGCG
GCGAGGAGCACGTCAAGCTCAGTACAGAGTACGGGGGAAAAACGCAGCTGAATTTAGGGCACAACGTTGA
TGCTGCCCGCGAACCGCGCGGCGAGGGTGCGGAGTTACGTACCGATCGGTATGTGTCCATCCGGGGTGGT
GCCGGAGTGTTCATCACCGCTGATAAACAGCCGTTTGCCAGCGATAAGATGCTGTCCATGCGGGAAGCGA
TATCTCAACTGGAAAATGCATTAAGTATTGCCAGAAGCCTTTCTGATGCTGCCGAAACGGCAGACGCATT
GCCAGCAGATATTCAGAGCCAGGTTAATCTGACAGATGCCCTGAAAGACCTTGTCCAGCCTGGAATGGTG
CTGAATGCGCCTGAAGGTGTGAGCATCACTAGCCCACAGGCGGTTCGTATGGCATCGGGGAGTGCAAGCG
TCGGGATTATGTCCCAGCAGAATACAGACATCAGCGCGCTTAAGCGTTTTACTGTGGCAGCGGGTGAAGC
TGTGAGTATGCTGGCCCGAAAGGCCGGGATGAAGCTTTTTGCGGCGAAGGGCAAAGTAGAAATCCAGGCT
CAGGATGATGCGATTGAGGCTATTGCAAAAAAAGACGTCACGGTGACCAGTGTGGAAGGCAAAGTAGTCA
TCACAGGGGCAACAGAGCTGGTTGTTAACTGTGACGGTGCATTTATAAAGCTGGCGGGAGGAGATATGGA
GTTCGGTGCTCCAGGAAATATTCTACTGAAATGTGCCAACGTTCAGAAAATGGGAAGTGCGGACTATGAC
GCACCTAAACCGGAACTTCCGCAAGGATATAGTGAGAACTTTATTGCACAGGATAAGGAGTCTGGCGATA
TCCTGGCTAATACGCGATATCGGATAACCACTGCTGATGGTTCTGTTTATGAAGGGCGTACTGACAGTGA
AGGTAAGACAGCTGAAATATTCGGTGTGGCAAAAAGCAAAATCAATATTGAACTACTCGGTGGCTAA
 Primer design