SecReT6
Protein ID: 470463053
SecReT6 ID738
T6SS typei2
Gene symbol-
Locus tagETAC_09415
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2151690..2154362 [-]
Producttype VI secretion ATPase, ClpV1 family protein
NoteTssH
UniProt IDM4TJB7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.40E-39, Aligned region: 236..255
AAA_2 [PF07724], Evalue: 1.40E-39, Aligned region: 609..774
AAA [PF00004], Evalue: 2.70E-19, Aligned region: 238..371
AAA [PF00004], Evalue: 2.70E-19, Aligned region: 614..732
AAA_5 [PF07728], Evalue: 1.40E-14, Aligned region: 238..258
AAA_5 [PF07728], Evalue: 1.40E-14, Aligned region: 323..368
AAA_5 [PF07728], Evalue: 1.40E-14, Aligned region: 613..733
ClpB_D2-small [PF10431], Evalue: 2.50E-14, Aligned region: 521..551
ClpB_D2-small [PF10431], Evalue: 2.50E-14, Aligned region: 780..854
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 139..147
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 215..260
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 283..316
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 454..511
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 596..649
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 677..707
AAA_16 [PF13191], Evalue: 2.10E-10, Aligned region: 754..838
AAA_22 [PF13401], Evalue: 2.40E-09, Aligned region: 237..323
AAA_22 [PF13401], Evalue: 2.40E-09, Aligned region: 610..650
Arch_ATPase [PF01637], Evalue: 3.80E-07, Aligned region: 216..253
Arch_ATPase [PF01637], Evalue: 3.80E-07, Aligned region: 290..387
Arch_ATPase [PF01637], Evalue: 3.80E-07, Aligned region: 606..651
AAA_25 [PF13481], Evalue: 7.60E-07, Aligned region: 238..298
AAA_25 [PF13481], Evalue: 7.60E-07, Aligned region: 361..398
AAA_25 [PF13481], Evalue: 7.60E-07, Aligned region: 609..642
Clp_N [PF02861], Evalue: 1.90E-06, Aligned region: 22..59
Clp_N [PF02861], Evalue: 1.90E-06, Aligned region: 110..125
Clp_N [PF02861], Evalue: 1.90E-06, Aligned region: 865..884
IstB_IS21 [PF01695], Evalue: 3.50E-06, Aligned region: 232..261
IstB_IS21 [PF01695], Evalue: 3.50E-06, Aligned region: 613..631
Zeta_toxin [PF06414], Evalue: 1.60E-05, Aligned region: 232..262
Zeta_toxin [PF06414], Evalue: 1.60E-05, Aligned region: 600..653
NACHT [PF05729], Evalue: 1.90E-05, Aligned region: 238..267
NACHT [PF05729], Evalue: 1.90E-05, Aligned region: 613..634
AAA_17 [PF13207], Evalue: 2.90E-05, Aligned region: 238..300
AAA_17 [PF13207], Evalue: 2.90E-05, Aligned region: 612..648
AAA_19 [PF13245], Evalue: 6.70E-05, Aligned region: 235..260
AAA_19 [PF13245], Evalue: 6.70E-05, Aligned region: 431..464
AAA_19 [PF13245], Evalue: 6.70E-05, Aligned region: 609..635
Sigma54_activat [PF00158], Evalue: 7.30E-05, Aligned region: 222..252
Sigma54_activat [PF00158], Evalue: 7.30E-05, Aligned region: 613..730
AAA_29 [PF13555], Evalue: 9.00E-05, Aligned region: 232..254
AAA_29 [PF13555], Evalue: 9.00E-05, Aligned region: 609..639
AAA_14 [PF13173], Evalue: 0.00022, Aligned region: 238..319
AAA_14 [PF13173], Evalue: 0.00022, Aligned region: 611..695
AAA_18 [PF13238], Evalue: 0.00079, Aligned region: 238..262
AAA_18 [PF13238], Evalue: 0.00079, Aligned region: 614..638
DUF258 [PF03193], Evalue: 0.0024, Aligned region: 224..255
DUF258 [PF03193], Evalue: 0.0024, Aligned region: 612..625
SRP54 [PF00448], Evalue: 0.0024, Aligned region: 238..260
SRP54 [PF00448], Evalue: 0.0024, Aligned region: 612..644
RNA_helicase [PF00910], Evalue: 0.0042, Aligned region: 239..260
RNA_helicase [PF00910], Evalue: 0.0042, Aligned region: 614..635
RNA_helicase [PF00910], Evalue: 0.0042, Aligned region: 711..731
ABC_tran [PF00005], Evalue: 0.0054, Aligned region: 52..139
ABC_tran [PF00005], Evalue: 0.0054, Aligned region: 238..257
ABC_tran [PF00005], Evalue: 0.0054, Aligned region: 612..645
Protein Sequence: 890 a.a.     [Download]
>gi|470463053|ref|YP_007629364.1| type VI secretion ATPase, ClpV1 family protein [Edwardsiella tarda C07-087]
MENPAILLRRLHPYCARALEGAASLCQTRGHAEILPEHWLLKLLEQGEGDLTVLARRYEWDMDALWQDLL
AWLDKQPRSVRSRPQLSAAIQTLMQQAWLLASLNSEERIRSVHLLMALVETPSLARCDGLWPLLTLGQRQ
LERLRPLLDAQSDERPDRPPASALAQSHAEDRAGAEHPADAQRNAGELSPALRSALDKFTLDVTAKAKAG
SIDPVFGRDSEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPDALKPVVLRTLDLGLL
QAGAGVKGEFEQRLKNVIDAVQQSSVPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAATT
WSEYKQYFERDAALERRFQRVLVDEPDDDTACLMLRGLKSRYAEHHGVHITDAAVRAAVTLSRRYLTGRQ
LPDKAVDLLDTAAARVRMSLDTVPEAIALLSAQRTALELEAQALRDDAAVGDSQQGERLCAIARQQSALE
NRLQQQARFEQQKEIALQLMASRQDISQRADMCALQRQLDRARQDDGLIQIDVDPRAVANVIADWTGVPL
SALMKDEQSELLTLEAAIGQRVVGQDIALMAIAQRLRAAKTGLTSENGPQGVFLLVGPSGVGKTETALAL
ADVLYGGEKSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVMS
LFYQVFDRGVMRDGEGREIDFRNTVILMTANLGSDPLMQRLDERPDASEAALYELLHPILRAHFQPALLA
RFQTVIYRPLNEPAMRSIVAMKLDQVSKRLNRHYGLTTQIDESLYDALTAACLLPDTGARNVDSLLNQQI
LPVLSQQLLAHMAARQKPQSLCLSWSEEEGIGLEFLGAAEANPEVGNVHS
 
Nucleotide Sequence: 2673 bp     [Download]
>gi|470461182|ref|NC_020796.1|:c2154362-2151690 Edwardsiella tarda C07-087, complete genome
ATGGAAAATCCCGCCATCCTGCTGCGTCGACTACATCCTTACTGCGCCCGCGCGCTGGAAGGTGCCGCCT
CCCTGTGCCAGACCCGCGGCCATGCGGAGATCCTGCCTGAGCACTGGCTGCTTAAGCTGCTGGAGCAGGG
CGAAGGCGACCTAACGGTGCTGGCGCGCCGCTACGAATGGGATATGGATGCCTTGTGGCAGGATCTGCTG
GCCTGGCTGGATAAACAGCCGCGTTCGGTGCGCAGCCGCCCGCAGCTATCCGCCGCTATCCAGACGCTGA
TGCAGCAGGCCTGGCTGCTGGCCTCGCTGAACAGCGAAGAGCGCATCCGCAGTGTGCACCTGCTGATGGC
GCTGGTGGAGACACCGAGCCTGGCGCGCTGCGATGGCCTGTGGCCGCTGCTGACCCTGGGCCAGCGTCAG
CTTGAGCGCCTGCGCCCGCTGCTGGATGCGCAGTCGGACGAACGCCCGGATAGACCGCCGGCGTCGGCGC
TTGCGCAGAGTCACGCTGAGGATAGGGCGGGAGCTGAACACCCGGCCGACGCGCAGAGAAATGCGGGCGA
ACTCAGCCCGGCCCTGCGGAGCGCCCTGGATAAGTTCACTCTCGACGTTACCGCCAAAGCGAAAGCGGGT
AGCATCGACCCGGTCTTCGGCCGTGACAGCGAAATTCGCCAGATGGTCGATATTCTCTCGCGCCGGCGTA
AGAACAACCCAATCCTGGTGGGGGAGCCGGGGGTGGGTAAAACCGCACTGGTCGAAGGCCTGGCGCTGCG
CATCGCCGAGGGCAACGTACCGGACGCCCTTAAGCCGGTCGTCCTGCGCACCCTTGACCTCGGCCTGTTG
CAGGCGGGGGCGGGGGTGAAAGGCGAGTTTGAACAGCGCCTGAAAAACGTGATCGACGCCGTGCAGCAGT
CGTCGGTGCCTGTCCTGCTGTTTATCGACGAAGCGCACACCATCATCGGCGCCGGTAACCAGGCCGGCGG
CGCGGATGCGGCTAATCTGCTGAAACCCGCCCTGGCGCGCGGTGAGCTGCGCACTATCGCCGCCACCACC
TGGTCTGAATATAAGCAGTACTTCGAGCGCGACGCCGCGCTGGAGCGCCGTTTCCAGCGGGTGTTGGTGG
ACGAACCGGATGATGACACCGCCTGCCTGATGCTGCGCGGCCTGAAGTCCCGCTACGCCGAACACCACGG
TGTGCACATTACCGATGCCGCGGTGCGCGCCGCCGTCACGCTGTCGCGCCGCTACCTGACCGGGCGTCAG
CTGCCGGATAAAGCCGTGGATCTGCTGGACACCGCCGCCGCCCGCGTACGTATGAGCCTGGATACCGTGC
CGGAGGCGATCGCTCTCCTGAGCGCGCAGCGGACGGCGCTGGAATTAGAAGCGCAGGCGCTGCGGGACGA
TGCCGCCGTCGGCGACAGCCAACAGGGTGAGCGCCTGTGCGCTATCGCCCGGCAGCAGAGCGCGCTGGAA
AACCGCCTGCAGCAGCAGGCACGCTTTGAACAGCAAAAAGAGATCGCCCTGCAGCTGATGGCCAGCCGTC
AAGATATCAGTCAGCGGGCCGACATGTGTGCGCTGCAGCGGCAGCTGGATCGGGCGCGGCAGGATGACGG
GCTGATCCAGATTGATGTCGATCCCCGCGCGGTGGCCAACGTGATTGCCGACTGGACCGGCGTGCCGCTC
TCCGCGCTGATGAAAGACGAGCAGAGTGAACTGCTGACCCTGGAGGCTGCCATCGGCCAGCGGGTGGTGG
GGCAAGATATCGCCCTGATGGCCATCGCGCAGCGCCTGCGCGCGGCCAAAACCGGCCTGACGTCGGAAAA
CGGCCCGCAGGGGGTGTTCCTGCTGGTGGGGCCCAGCGGCGTCGGTAAAACCGAAACCGCCCTGGCGCTG
GCCGATGTGCTGTACGGCGGCGAGAAGTCGCTGATCACCATCAACTTGTCCGAATACCAGGAGCCGCACA
CCGTTTCCCAACTCAAAGGCTCACCGCCGGGCTACGTCGGCTACGGTCAGGGCGGCATCCTCACCGAAGC
GGTGCGTAAGCGCCCGTACAGCGTGGTGCTGCTGGATGAAGTGGAAAAGGCGCACCGCGACGTGATGAGC
CTGTTCTATCAGGTGTTCGATCGCGGCGTCATGCGCGACGGCGAGGGGCGTGAAATCGACTTTCGCAACA
CCGTCATTCTGATGACCGCCAACCTGGGCAGCGACCCGCTGATGCAGCGGCTCGATGAACGGCCAGACGC
CAGCGAGGCGGCGCTGTATGAGCTGCTGCACCCGATCCTGCGCGCCCACTTCCAGCCCGCGCTGCTGGCC
CGCTTTCAAACCGTGATCTACCGGCCGCTGAATGAGCCTGCCATGCGCAGCATCGTGGCAATGAAGCTCG
ACCAGGTCAGCAAGCGCCTCAACCGCCACTACGGCCTGACCACGCAGATTGATGAAAGCCTATACGACGC
GCTGACCGCCGCCTGCCTGCTGCCGGATACCGGCGCGCGCAACGTCGACAGCCTGCTCAATCAACAGATC
CTGCCGGTGCTCAGCCAGCAGCTGCTGGCCCACATGGCGGCCAGACAGAAACCTCAGTCGCTATGCCTTA
GCTGGAGTGAGGAAGAGGGTATCGGGCTGGAGTTTTTAGGCGCGGCTGAAGCTAATCCGGAGGTAGGGAA
TGTCCATTCATGA
 Primer design