SecReT6
Protein ID: 470463054
SecReT6 ID738
T6SS typei2
Gene symbol-
Locus tagETAC_09420
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2154536..2155027 [-]
Productcytoplasmic protein USSDB7A
NoteTssD
UniProt IDM4U0K7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.00E-37, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|470463054|ref|YP_007629365.1| cytoplasmic protein USSDB7A [Edwardsiella tarda C07-087]
MAIPVYLWLKDDGGAAIKGSVDVQDRDGSIEVVAQQHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDSASP
YLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVNPVMHDIKDPAYEKHNHLEQIELRYE
KITWTYKDGNIIHSDSWNERATA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|470461182|ref|NC_020796.1|:c2155027-2154536 Edwardsiella tarda C07-087, complete genome
ATGGCAATTCCTGTTTATCTGTGGCTGAAAGACGACGGCGGCGCGGCCATTAAAGGGTCCGTGGACGTTC
AGGATCGTGATGGCAGCATCGAGGTGGTGGCGCAGCAGCATAACCTGTATATCCCGACCGATAACAATAC
CGGCAAGCTGACCGGCACCCGTATCCACACCCCGTTCCTGTTCACCAAGGAAATCGACTCCGCCAGTCCG
TACCTGTACAAGGCGGTGACCACCGGACAGACCCTGAAGTCCGCGGAGTTCAAGTGGTACAAAATCAACG
ACGCGGGCCAGGAGGTGGAGTACTTCAACACCAAACTGGAAAACGTGAAGGTGGTGAAAGTGAATCCGGT
GATGCATGACATCAAGGATCCGGCCTACGAGAAGCACAACCACCTGGAGCAGATCGAACTGCGCTACGAA
AAAATCACCTGGACCTACAAAGACGGCAACATCATTCACTCCGACTCCTGGAACGAGCGCGCCACCGCCT
AA
 Primer design