SecReT6
Protein ID: 470463055
SecReT6 ID738
T6SS typei2
Gene symbol-
Locus tagETAC_09425
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2155033..2156778 [-]
Producthypothetical protein
NoteTagL
UniProt IDM4TL35, M4TL35
KEGG IDetc:ETAC_09425
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.70E-17, Aligned region: 51..64
OmpA [PF00691], Evalue: 2.70E-17, Aligned region: 451..547
Protein Sequence: 581 a.a.     [Download]
>gi|470463055|ref|YP_007629366.1| hypothetical protein ETAC_09425 [Edwardsiella tarda C07-087]
MRDVYRGLLTALAGVLALWLILGFWPLSVGSRVAFSLLVSLVCGVMLWRQQRASQRRTQALRAAVDESLP
PEAFKGSVILVCGDSGALFAGEMQHRETRQGWYLRVNDADQLPELAQYLCQARPALELQLSVLLAVLPER
HTRDADFTQHLLRWQRAVAQCRVALGWLPPLWVVAWLSPPAAGADMGPVWFTTLSQRSGIQVYQPGRGHQ
TLTDWGRDPAADERLSRLSQGLWLDRGLAWLNRTVIRPLSARHGDLPTMKPCAFGLCLVPVKGGADNLWQ
HHIASVTALPPDAMDNDAPLPLPELLLPALPRRRGVSLQMVFWRYAGLLGGIFLALAMLASWVNNQRLIR
NVGDHLALYHHLTGTPVAPKLRAQQRLRADGARLDDWQRRGEPVRYRLGLYQGLRLLPVVEAAVNDWAPP
PPLSPHSSSPPVIEHTIPAAPKTIRLDSLSLFDPGKSVLKAGSSKMLVNALVDIRAKNGWLIVVRGYTDS
TGSRALNYTLSQQRAESVRNWIRDTGDVPERCFAVQGYGADRPIATNDTAAGRALNRRVEISLVPQANAC
QIPGNTLRSSQNDDGNNTVME
 
Nucleotide Sequence: 1746 bp     [Download]
>gi|470461182|ref|NC_020796.1|:c2156778-2155033 Edwardsiella tarda C07-087, complete genome
ATGCGTGATGTTTACCGGGGTCTGTTAACTGCCTTGGCGGGCGTACTGGCACTGTGGCTTATCTTGGGCT
TCTGGCCGCTGTCGGTCGGGAGTCGTGTGGCATTCAGCCTGCTGGTCTCTCTGGTATGCGGTGTGATGCT
CTGGCGTCAGCAGCGGGCATCGCAGCGGCGAACTCAGGCGCTGAGGGCGGCGGTGGACGAGAGCCTGCCG
CCGGAAGCGTTTAAGGGATCCGTCATTCTGGTCTGTGGCGATAGCGGCGCGCTTTTCGCTGGGGAGATGC
AGCATCGTGAGACGCGTCAGGGGTGGTATCTGCGCGTAAACGACGCCGATCAGTTGCCCGAGCTGGCGCA
GTACCTGTGTCAGGCTCGCCCAGCGCTGGAGCTACAACTCTCCGTATTGCTGGCCGTATTGCCAGAGCGC
CATACCCGGGACGCTGATTTTACTCAGCATCTGCTCCGCTGGCAGCGTGCGGTGGCGCAGTGTCGCGTGG
CGCTTGGCTGGCTTCCGCCATTGTGGGTGGTGGCGTGGCTGTCACCGCCGGCCGCGGGTGCAGATATGGG
ACCGGTCTGGTTTACCACCCTCAGCCAGCGGTCGGGTATTCAGGTGTATCAGCCTGGACGGGGTCATCAG
ACTCTGACCGATTGGGGTCGGGATCCGGCGGCGGACGAGCGCCTTTCCCGCTTGAGTCAGGGGCTGTGGC
TTGACCGTGGGCTCGCCTGGCTGAATCGCACCGTTATCCGCCCGTTGTCGGCCCGCCACGGTGATTTGCC
GACGATGAAACCCTGTGCATTCGGCCTATGTCTGGTGCCGGTGAAGGGGGGTGCCGATAACCTCTGGCAG
CATCACATCGCCTCTGTCACTGCGCTGCCACCAGATGCGATGGATAACGATGCGCCTTTGCCGTTGCCTG
AGCTTCTGCTGCCGGCGCTGCCGCGTCGTCGTGGTGTCAGCCTTCAGATGGTGTTCTGGCGCTATGCCGG
GCTGCTGGGGGGGATTTTCCTGGCGCTGGCGATGCTGGCATCCTGGGTAAACAACCAGCGTTTGATCCGC
AATGTCGGTGACCATCTTGCCTTATATCACCATCTTACCGGCACACCCGTCGCGCCGAAGCTCCGTGCGC
AGCAGCGGCTGCGCGCCGATGGCGCACGGCTGGACGACTGGCAGCGTCGCGGTGAGCCTGTGCGCTATCG
CCTCGGGCTGTATCAGGGGCTGCGTCTGCTTCCCGTCGTGGAGGCGGCAGTAAACGACTGGGCGCCACCT
CCGCCGTTATCTCCGCATTCATCTTCACCTCCTGTTATTGAACACACGATCCCGGCGGCGCCGAAAACCA
TTCGCCTTGACAGCCTGTCGCTGTTCGATCCCGGTAAATCGGTGCTGAAAGCGGGCTCCAGCAAAATGCT
GGTCAACGCGCTGGTCGATATCCGAGCCAAAAACGGCTGGCTGATCGTCGTCCGTGGCTACACCGACAGC
ACCGGCAGCCGCGCACTGAATTACACGCTGTCGCAGCAACGCGCTGAATCCGTACGCAACTGGATACGGG
ATACCGGCGATGTGCCGGAGCGCTGTTTTGCGGTTCAGGGATATGGAGCGGACCGTCCCATCGCAACCAA
TGACACCGCGGCGGGGCGTGCGCTCAACCGCCGTGTCGAAATCAGCCTGGTACCCCAGGCCAACGCCTGC
CAGATACCGGGCAACACCCTCAGGTCATCGCAGAATGATGACGGTAATAACACTGTAATGGAGTAA
 Primer design