SecReT6
Protein ID: 470463056
SecReT6 ID738
T6SS typei2
Gene symbol-
Locus tagETAC_09430
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2156782..2157435 [-]
Producttype VI secretion system protein ImpK
NoteTssL
UniProt IDM4TMK6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.70E-42, Aligned region: 9..205
Protein Sequence: 217 a.a.     [Download]
>gi|470463056|ref|YP_007629367.1| type VI secretion system protein ImpK [Edwardsiella tarda C07-087]
MNRPGISQIEQIFYPGWLMASQLRGGQEVRDGEGLYRRACRLVQEARTALAEAGYSDISRDHMVYALCAL
LDESVLNRGTLDDGYLNWRRDPLQAHFFGTLNAGEELWERIRNLLKASAPDTAVLTCMYRTLQLGFVGQY
RAQDDERREDVVRALGERVPAFTVAQDAPMVIRASHLRSGRRLFWISWIIGAAALAALWCILSSSLTDLV
GQTIRLG
 
Nucleotide Sequence: 654 bp     [Download]
>gi|470461182|ref|NC_020796.1|:c2157435-2156782 Edwardsiella tarda C07-087, complete genome
ATGAATAGACCCGGTATCAGTCAAATTGAGCAGATTTTTTATCCGGGCTGGCTGATGGCCAGTCAGCTGC
GCGGTGGACAGGAAGTCCGAGATGGAGAGGGGCTCTATCGCCGGGCCTGCCGTCTGGTGCAGGAGGCGAG
AACTGCGCTGGCGGAGGCCGGCTACAGCGATATCAGCCGGGATCACATGGTATACGCCCTATGTGCCCTG
CTTGATGAGAGTGTTCTGAACCGGGGAACCCTCGATGACGGTTACCTGAACTGGCGCCGCGACCCACTTC
AGGCCCACTTCTTTGGCACCCTGAACGCCGGGGAGGAGCTGTGGGAGCGTATCCGCAACCTGCTGAAAGC
GTCCGCCCCGGACACCGCCGTACTCACCTGCATGTACCGTACTCTGCAGCTGGGGTTCGTCGGTCAGTAT
CGCGCCCAGGATGACGAGCGCCGTGAAGACGTGGTACGTGCGCTGGGAGAACGGGTGCCGGCCTTTACGG
TTGCCCAGGATGCGCCGATGGTTATCCGAGCATCCCACCTACGCAGCGGCCGCCGTCTGTTCTGGATCTC
CTGGATTATCGGGGCGGCGGCCCTGGCGGCGCTGTGGTGCATTCTTTCCTCCTCTCTCACCGACCTGGTG
GGCCAGACGATCAGGCTGGGGTAA
 Primer design