SecReT6
Protein ID: 470463057
SecReT6 ID738
T6SS typei2
Gene symbol-
Locus tagETAC_09435
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2157432..2158769 [-]
Producthypothetical protein
NoteTssK
UniProt IDM4TIR1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.50E-126, Aligned region: 18..442
Protein Sequence: 445 a.a.     [Download]
>gi|470463057|ref|YP_007629368.1| hypothetical protein ETAC_09435 [Edwardsiella tarda C07-087]
MKIFRPLWEDGAALAPQQFQQQAHWSAYVADRVARMGISHPWGVAVAEFDDAALALSRLNATRLVVRFQD
GTIVDTDLADTLPPVCDLSAASGAESIDVVAALPLLSASGGNLDNGQDSERPRRWKAERVVVQDLVGHES
GELAILRHAITLRLSSQENSAYLTCPVARLARNALGLWSRDPAFIPPMLSATASPVLMTELGDLLVRLQA
RRTRLMAMRRESNERMADFAVADVSLFWLLNALNSAEPVLVELLQTPGRHPELLYRELARLAGSLLTFSL
EHGAGDIPVYQHDMPERVFPPLLTLLDKLLEASLPSRVISIQLEHQEQMWKGTLHDARLREGADFYLSVR
SSMPNHELQTKFPLLCKAGSFADVSDVVNVALSGMMIKPLTHVPAAIPLRLENQYFSLDLSSEAARSMLE
MGSCTLYTPRSLGEVKLELFAVLRT
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|470461182|ref|NC_020796.1|:c2158769-2157432 Edwardsiella tarda C07-087, complete genome
ATGAAGATTTTTCGCCCACTTTGGGAGGATGGGGCCGCTCTGGCCCCGCAACAGTTCCAGCAGCAGGCCC
ACTGGAGTGCGTACGTTGCCGACAGGGTCGCACGGATGGGAATTTCTCATCCCTGGGGCGTGGCTGTGGC
TGAATTTGATGATGCCGCGCTAGCGCTTTCGCGCCTGAATGCTACCCGTCTGGTGGTCCGTTTCCAGGAT
GGCACGATTGTTGATACGGATTTGGCAGATACGCTTCCGCCAGTCTGTGATTTATCCGCCGCCTCCGGCG
CTGAATCCATTGACGTGGTTGCCGCGCTGCCACTGCTGAGCGCCAGTGGCGGCAACCTGGATAATGGTCA
GGACAGTGAGCGCCCGCGCCGCTGGAAAGCTGAGCGCGTTGTGGTCCAGGATCTGGTCGGGCATGAAAGT
GGTGAGCTGGCCATTCTGCGTCATGCCATTACGCTTCGTCTGTCCTCGCAGGAAAATAGCGCCTACCTGA
CCTGTCCGGTCGCTCGCCTAGCACGTAACGCCCTGGGGCTGTGGAGCCGTGACCCGGCCTTTATCCCGCC
GATGCTGTCGGCTACGGCAAGCCCTGTGCTAATGACTGAACTGGGCGACCTGCTGGTGCGCCTGCAGGCG
CGGCGTACGCGACTGATGGCGATGCGGCGTGAAAGCAACGAGCGTATGGCCGATTTTGCCGTGGCTGATG
TCTCTCTGTTCTGGTTGCTTAATGCGCTGAACAGCGCCGAGCCCGTGCTAGTCGAACTGCTGCAGACTCC
GGGACGTCATCCAGAGTTGCTGTATCGTGAGCTGGCCCGTCTTGCGGGCAGTCTACTGACGTTTTCACTG
GAGCATGGTGCCGGTGATATTCCTGTTTATCAGCATGATATGCCTGAACGTGTGTTCCCGCCGTTACTGA
CGCTGCTTGATAAGCTGCTGGAAGCCAGCCTGCCATCGCGAGTGATCAGCATTCAGCTTGAGCATCAGGA
GCAAATGTGGAAAGGCACCTTGCACGATGCGCGCCTGCGCGAAGGGGCCGATTTCTATCTCTCCGTGCGC
TCCTCCATGCCGAATCATGAACTGCAGACCAAATTCCCGCTGTTGTGTAAGGCGGGTAGCTTTGCCGATG
TCTCAGATGTGGTGAATGTGGCCCTGAGCGGGATGATGATCAAACCGCTGACGCATGTGCCGGCGGCAAT
TCCTTTGCGCCTAGAGAACCAGTACTTCTCACTGGATCTGAGCTCAGAGGCGGCCCGTAGCATGCTGGAA
ATGGGAAGCTGCACCCTCTACACCCCGCGCTCGCTGGGGGAGGTAAAACTTGAACTCTTCGCGGTGTTGC
GCACATGA
 Primer design