SecReT6
Protein ID: 470463058
SecReT6 ID738
T6SS typei2
Gene symbol-
Locus tagETAC_09440
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2158788..2160329 [-]
Producthypothetical protein
NoteTssC
UniProt IDM4TJC1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.90E-176, Aligned region: 88..509
Protein Sequence: 513 a.a.     [Download]
>gi|470463058|ref|YP_007629369.1| hypothetical protein ETAC_09440 [Edwardsiella tarda C07-087]
MSVQNTTSESGERLALEKAAGGNVYASLFEKINLTPVERLSDIHIWQDSQAMAEASADERITAAMQVFLQ
RLKQSGTSIEKLDKTLLDHHIAELDHQISRQLDAVMHHPEFQQVESLWRGLKSLVDKTDFRQNVKLEILD
LSKDDLRQDFEDAPEIIQSGLYRQTYIAEYDTPGGEPIGALISAYEFDASAQDMALLRNISKVSAAAHMP
FIGAVGPAFFLKDSMEEVAAIKDIGNYFDRAEYIKWQSFRETDDARYIGLTLPRVLGRLPYGPDTVPVRS
FNYVEEVKGPDHSKYLWTNAAFSFAANMVRSFINNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKIPS
EVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPAIYDTPDATANSRINARLPYIFLLSRIAHY
LKLIQRENIGTTKDRRLLELELNNWIRGLVTEMTDPGDALQASHPLRDGNVVVEDIEDNPGFFRVKLFAV
PHFQVEGMDVNLSLVSQMPKAKS
 
Nucleotide Sequence: 1542 bp     [Download]
>gi|470461182|ref|NC_020796.1|:c2160329-2158788 Edwardsiella tarda C07-087, complete genome
ATGTCTGTACAGAATACTACCTCAGAGTCGGGTGAGCGTCTTGCGCTGGAAAAGGCCGCGGGCGGTAATG
TGTATGCCTCACTGTTTGAAAAAATTAATTTAACGCCGGTGGAACGGCTCAGCGATATTCATATTTGGCA
GGATAGCCAAGCGATGGCAGAAGCCAGCGCGGATGAGCGTATTACCGCGGCGATGCAGGTTTTTTTGCAG
CGTCTCAAGCAGTCGGGGACGTCAATTGAAAAGCTGGATAAGACATTATTGGATCATCATATTGCCGAAT
TAGATCACCAGATCAGTCGACAGCTGGATGCCGTGATGCACCACCCCGAATTTCAACAGGTGGAGTCGCT
GTGGCGCGGTTTAAAATCGTTAGTCGATAAGACTGACTTTCGCCAGAATGTGAAGCTGGAAATCCTTGAC
CTGTCTAAAGACGATTTACGCCAGGATTTTGAAGACGCGCCGGAGATTATTCAGAGCGGCTTATACCGAC
AGACCTATATCGCCGAATACGATACGCCGGGGGGAGAGCCGATAGGCGCGCTGATCTCAGCCTATGAATT
TGATGCGTCGGCTCAGGATATGGCGTTACTGCGTAATATTTCTAAGGTGTCTGCGGCGGCGCATATGCCA
TTTATTGGTGCCGTGGGGCCGGCGTTCTTCCTCAAGGATTCAATGGAAGAGGTCGCGGCGATCAAGGATA
TCGGCAATTACTTCGATCGGGCTGAGTACATCAAATGGCAGTCCTTTCGTGAAACGGATGATGCGCGCTA
TATCGGCTTAACGCTGCCACGGGTACTGGGGCGTTTGCCCTATGGCCCGGATACCGTCCCGGTGCGCAGC
TTTAACTATGTGGAGGAGGTCAAGGGGCCGGATCACAGTAAATACCTGTGGACCAATGCGGCATTTTCCT
TTGCGGCCAACATGGTGCGCAGCTTCATCAACAACGGCTGGTGTGTACAGATCCGCGGCCCGCAGGCCGG
CGGTGCCGTTCAGGATCTGCCTATCCACCTGTACGATCTGGGTACCGGTAATCAGGTGAAGATCCCGTCG
GAGGTGATGATCCCGGAGACCCGTGAGTTTGAGTTTGCCAATTTGGGCTTTATTCCGCTCTCCTACTATA
AGAACCGCGACTACGCGTGTTTCTTCTCCGCCAACTCGGCGCAAAAGCCGGCTATTTACGATACCCCGGA
TGCGACGGCGAATAGCCGCATCAATGCGCGTCTGCCGTATATCTTCCTGCTGTCGCGTATTGCGCATTAT
CTGAAGCTGATCCAGCGTGAAAACATCGGCACCACTAAGGATCGGCGCCTGCTTGAGCTGGAGCTGAATA
ACTGGATCCGCGGACTGGTGACCGAAATGACCGATCCGGGCGACGCGCTGCAGGCGTCACACCCGCTACG
CGACGGCAACGTGGTGGTGGAGGATATTGAAGACAACCCGGGCTTCTTCCGCGTGAAACTCTTCGCCGTG
CCGCACTTCCAGGTCGAAGGGATGGACGTCAATCTGTCGCTGGTTTCTCAGATGCCTAAAGCGAAATCAT
AA
 Primer design