SecReT6
Protein ID: 470463059
SecReT6 ID738
T6SS typei2
Gene symbol-
Locus tagETAC_09445
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2160368..2160865 [-]
Producthypothetical protein
NoteTssB
UniProt IDM4U0L0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.30E-52, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|470463059|ref|YP_007629370.1| hypothetical protein ETAC_09445 [Edwardsiella tarda C07-087]
MAESFQGEVPKARVNIKLDLHTGQAKKQVELPLKLLAVGDFSNGQEQRPLSERSKVDVNKNNFNNVLADI
HPSVRMRVENTLASEGQDTAISLAFQHIDDFSPEQVARQIPQLRAMLAMRNLLRDLKSNLLDNTAFRKEL
ELILKDPTLSDELRNELSALAPKQA
 
Nucleotide Sequence: 498 bp     [Download]
>gi|470461182|ref|NC_020796.1|:c2160865-2160368 Edwardsiella tarda C07-087, complete genome
ATGGCAGAGAGTTTCCAGGGTGAGGTGCCGAAGGCACGGGTTAATATTAAATTAGATCTGCACACGGGAC
AGGCAAAAAAACAGGTTGAATTACCCTTGAAGTTACTGGCGGTAGGCGACTTCAGCAATGGCCAGGAGCA
GCGACCTTTATCCGAACGGAGTAAGGTTGACGTTAATAAAAACAATTTTAACAACGTGCTGGCCGATATC
CACCCGAGCGTCAGAATGCGCGTTGAAAACACCCTGGCCAGTGAAGGGCAAGACACCGCTATTTCGCTTG
CATTTCAGCATATTGATGACTTCTCACCGGAGCAGGTTGCCCGTCAGATCCCACAGCTGCGCGCGATGTT
GGCCATGCGCAATTTGCTGCGCGATCTGAAATCTAACCTCCTGGACAATACGGCATTTCGTAAAGAGCTG
GAGCTGATTTTAAAAGATCCGACATTGAGTGATGAGCTGCGTAATGAGCTGTCCGCTCTGGCGCCAAAGC
AGGCGTAA
 Primer design