SecReT6
Protein ID: 470463484
SecReT6 ID739
T6SS typei4b
Gene symbol-
Locus tagETAC_11570
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2623303..2627085 [+]
Producttype VI secretion system protein EvpO
NoteTssM
UniProt IDM4U1U7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.90E-52, Aligned region: 169..423
DUF1215 [PF06744], Evalue: 0.0016, Aligned region: 938..988
DUF1215 [PF06744], Evalue: 0.0016, Aligned region: 1006..1022
Protein Sequence: 1260 a.a.     [Download]
>gi|470463484|ref|YP_007629795.1| type VI secretion system protein EvpO [Edwardsiella tarda C07-087]
MKRLFKWIAIVVLLSVLAMLCWLLTLWQRWPAAAAWVLFLAILAGALLTRYLWRKVRAWRTRSLEAEPVE
KARAAERHPMTLQRQWKAATTLLKHSQLRRFRHPLQVLPWFMLLGRPGSGKSALLAQSGLAAPLDLPHEL
NDGKAPVDWWYFDKAVILDISGQFVQPEASQETRSTWNRMLDLLGRDRARAGLNGLVLTVSAQTLLSADG
GGVVDEGRLIRTRIEQLIRLFDRRFPVYVLVTQIDSLYGMEAWSHLLTPEALDQAMGHVVDEPENGRDVR
DVIDIALGRVNSRLKTMQLTMLLQHPDADPALLMFPTELARLAEPLKRYVYHALGDSPYLESPILRGVFF
ASAVQKGNTRSGPEDQQEIALQEAAHDTVKRGVFVRDLFNRVLPADRHLNRPVAVTSPWRRLNRHLGLFA
WWLCVAAALGYLGVSVVYWQHTLDDLRQRYPATMAMNRALPHDMQMMIAQRDAIYWLENRNAQWASRVLA
FQHQLLSVEADAKSQYVNDFSQYILPSLDKAIQQSTTADSIASHPDGLVNAIQVEVRRANLLRARLRGSS
YGALMAMPPIPTPPLRLLYPALDSDTVSRFNDLFLAQLAWSTDIQQQNARLLHLQARLRQLAAQSATLDW
IIPWANAQPDLTSVTLDDFWQGSLRPDKLPEVDAAYTLEGQQRIRAFLVEMRSSMPNDIAFDKKRAAFWH
EYAQKRLQAWQDFAGQFSQGERILAGQGEWQSTIDRLPHDDNPYLRLARRLLTEFAEMPDDLRPGWLRVL
PQWLEIRQRAHQQALVRVPGLVSDVGGMILRGTAQKGALDQTRSQLVGRLDAIRLYQEYQAAMTQAMNSV
VISQAQATKVAADFHGFDSQQSGQSSLQTAYARLMSLRSLLGYNRPDEQLTWGLMAGPLQLVIRYADQQA
SCFLQSAWQDRVIAPSRWTLNQAERADKLYGDNGLLWTFLSGPIKPFIQRNDSGWQEVDTLGQSVPFTAD
FLPFINRALIRQVDLKAGKIALHQKQQQATLAQQQQKQRWQTVAAESGEKLAELNTAAAALKAKSYPVAL
TGLPTDVNSNAKAKVVGTLLTMQCTNATLRLNNLNFAVMQSVLWSQQQCGQVTLQIRLPTFTLTRSYPGP
QGFVHFLRDFPGGARRFTPADFPVDKSRMAAVGLTQITVRYRIAGQETLLQDAAQLAQAERDIQSAQTRQ
QQAQQALLTLNRPSASESLPPLDTLPGLTMMSVPERIGQCWRGDIRLARENDGIGRLMSELVAKQLSDKP
 
Nucleotide Sequence: 3783 bp     [Download]
>gi|470461182|ref|NC_020796.1|:2623303-2627085 Edwardsiella tarda C07-087, complete genome
ATGAAACGTCTCTTCAAATGGATAGCGATCGTCGTGCTCCTGAGCGTACTGGCGATGCTGTGCTGGCTGC
TCACGCTGTGGCAACGCTGGCCCGCCGCCGCCGCATGGGTGCTGTTTCTCGCCATTCTGGCCGGCGCCCT
GCTGACCCGCTATCTCTGGCGTAAGGTGCGGGCATGGCGTACCCGCAGCCTGGAGGCGGAGCCGGTTGAA
AAAGCCCGAGCCGCGGAGCGCCATCCCATGACGCTACAGCGCCAGTGGAAAGCCGCCACGACCCTGCTGA
AGCACTCTCAGCTGCGCCGGTTCCGCCACCCGCTGCAGGTTCTGCCCTGGTTTATGCTGCTGGGCCGCCC
GGGATCGGGAAAATCGGCGCTGCTGGCGCAGTCGGGCCTGGCCGCCCCCTTGGATTTGCCCCATGAGCTC
AATGACGGCAAGGCGCCCGTCGACTGGTGGTATTTCGACAAGGCCGTCATCCTGGATATCTCTGGCCAGT
TCGTACAGCCGGAGGCATCGCAGGAGACCCGCTCCACCTGGAACCGGATGCTGGATCTGCTGGGGCGCGA
TCGCGCCCGGGCCGGATTGAACGGGCTGGTGCTCACGGTATCGGCCCAGACCCTGCTGTCCGCAGACGGG
GGCGGCGTGGTCGACGAGGGACGGCTGATCCGCACTCGCATAGAGCAGCTGATCCGTCTGTTCGACAGGC
GCTTCCCCGTCTACGTGCTGGTGACCCAAATCGACAGCCTGTACGGCATGGAGGCCTGGTCCCACCTGCT
GACCCCGGAGGCGCTGGATCAGGCCATGGGCCATGTGGTGGACGAACCGGAGAACGGCCGCGACGTCCGC
GACGTGATAGATATCGCCTTGGGTCGGGTCAATAGCCGGCTGAAAACCATGCAGCTGACGATGCTGCTGC
AGCACCCGGATGCCGATCCGGCCTTACTGATGTTCCCCACCGAGCTGGCCAGGCTAGCCGAGCCCCTCAA
GCGCTATGTCTATCATGCCCTGGGAGACAGCCCCTATCTGGAGTCGCCCATCTTGCGCGGCGTATTCTTC
GCCAGCGCGGTCCAGAAGGGAAACACCCGCAGCGGGCCCGAAGATCAGCAGGAGATTGCGCTGCAGGAGG
CGGCGCATGACACCGTCAAACGCGGGGTCTTTGTCCGGGATCTGTTTAACCGCGTCCTGCCGGCCGACCG
TCATCTGAACCGCCCCGTCGCCGTGACCAGTCCCTGGCGGCGCCTGAACCGCCATCTGGGCCTGTTCGCC
TGGTGGCTGTGCGTGGCCGCCGCCCTCGGGTATCTCGGCGTATCGGTCGTGTACTGGCAGCACACGCTGG
ACGATCTGCGCCAGCGCTATCCGGCGACCATGGCCATGAATCGCGCCCTGCCCCACGACATGCAGATGAT
GATAGCCCAGCGGGATGCGATTTATTGGCTGGAAAACAGAAACGCGCAGTGGGCCAGCCGGGTACTGGCA
TTCCAGCATCAGTTGCTCTCGGTTGAAGCGGATGCAAAATCGCAGTATGTAAATGACTTTAGCCAATATA
TTTTACCCAGCCTGGACAAGGCGATTCAGCAGAGCACCACGGCGGACAGCATCGCATCCCATCCCGACGG
GCTGGTGAACGCCATTCAGGTGGAGGTCCGCCGCGCCAACCTGCTACGGGCGAGGCTGCGAGGCTCCAGC
TACGGAGCGCTGATGGCCATGCCCCCGATACCGACGCCTCCCCTGCGGTTACTGTACCCGGCGCTGGATT
CGGATACGGTATCCCGTTTCAATGACCTGTTCCTGGCCCAGCTGGCCTGGTCAACGGATATCCAGCAGCA
GAACGCCCGCCTGCTGCACCTGCAGGCGCGGCTCCGGCAGCTGGCGGCGCAAAGCGCCACCCTGGACTGG
ATCATTCCCTGGGCAAACGCCCAGCCGGATCTGACCAGCGTGACCCTGGACGACTTCTGGCAGGGCTCAC
TGCGGCCGGATAAATTGCCGGAGGTCGATGCGGCCTACACCCTGGAGGGGCAGCAGCGTATCCGCGCATT
CCTGGTGGAGATGCGCAGCAGCATGCCGAACGACATCGCCTTCGACAAAAAACGGGCCGCCTTCTGGCAT
GAATATGCGCAGAAGCGCTTGCAGGCCTGGCAGGACTTCGCCGGACAGTTCTCTCAGGGAGAGCGGATCC
TGGCAGGTCAGGGAGAGTGGCAGAGCACCATTGACAGACTGCCCCACGATGACAACCCGTATCTGCGCCT
TGCCCGCCGCCTGTTGACCGAGTTTGCCGAGATGCCGGATGACCTGCGCCCGGGCTGGCTCCGGGTGCTC
CCGCAGTGGCTGGAGATACGCCAGCGCGCCCACCAGCAGGCCCTCGTCAGGGTCCCCGGACTGGTCAGCG
ATGTGGGCGGCATGATCCTGCGCGGGACGGCGCAGAAGGGGGCGCTGGATCAGACCCGCAGCCAGCTCGT
CGGCCGGCTGGATGCCATCCGCCTGTATCAGGAGTATCAGGCGGCCATGACCCAGGCCATGAACAGCGTC
GTCATCAGCCAGGCCCAGGCCACCAAAGTGGCGGCGGACTTCCATGGCTTTGACAGCCAGCAGAGCGGGC
AGTCCTCACTGCAGACGGCCTATGCACGCCTGATGAGCCTGCGCAGCCTGCTGGGATACAATCGGCCCGA
TGAACAGCTCACCTGGGGGCTGATGGCGGGCCCCTTGCAGCTGGTCATTCGCTATGCCGATCAGCAGGCC
TCCTGCTTCCTGCAGAGCGCGTGGCAGGACCGCGTCATCGCGCCATCGCGCTGGACCCTCAATCAGGCCG
AGCGGGCAGATAAGCTGTACGGTGACAATGGGTTGCTCTGGACCTTTTTATCCGGGCCGATTAAGCCGTT
TATCCAACGTAACGATAGCGGCTGGCAGGAGGTGGATACGCTGGGGCAGTCCGTCCCCTTTACCGCAGAC
TTCCTGCCATTCATCAACCGGGCCCTTATCCGCCAGGTTGATCTGAAGGCCGGGAAAATCGCGCTGCACC
AGAAACAGCAGCAGGCCACCCTGGCCCAGCAGCAGCAAAAGCAGCGCTGGCAAACCGTGGCCGCCGAGTC
TGGCGAAAAGCTGGCCGAGCTGAACACCGCCGCCGCCGCCCTGAAGGCGAAAAGCTATCCCGTCGCCCTG
ACGGGGCTGCCGACGGACGTCAACAGCAACGCCAAGGCCAAGGTCGTGGGAACCCTGTTGACCATGCAGT
GTACCAATGCCACGCTGCGGCTAAACAACCTTAACTTTGCCGTGATGCAAAGCGTGCTCTGGTCACAGCA
GCAGTGCGGCCAGGTGACGCTGCAGATCCGGCTCCCGACCTTCACGCTGACGCGCAGCTATCCCGGGCCT
CAGGGCTTTGTCCACTTTTTACGGGATTTCCCGGGCGGGGCCCGCCGGTTTACCCCGGCGGACTTCCCCG
TCGACAAAAGTCGGATGGCGGCGGTCGGGCTAACCCAGATTACGGTACGCTACCGCATCGCCGGACAGGA
GACGCTGCTGCAGGACGCCGCTCAGCTGGCGCAGGCCGAGCGCGATATTCAGTCAGCCCAGACCCGCCAA
CAGCAGGCGCAGCAGGCCCTGCTGACGCTGAATAGGCCGAGCGCATCGGAGAGCCTTCCGCCGCTGGATA
CGCTGCCGGGGCTGACGATGATGAGTGTGCCGGAGCGCATCGGGCAGTGCTGGCGGGGGGATATTCGCCT
GGCCAGAGAAAACGACGGCATTGGCCGGCTGATGAGTGAACTGGTCGCGAAACAGTTAAGCGACAAGCCG
TAA
 Primer design