SecReT6
Protein ID: 470479712
SecReT6 ID741
T6SS typei1
Gene symbol-
Locus tagPCNPT3_08400
StrainPsychromonas sp. CNPT3
Repliconchromosome [GenBank: NC_020802] [Browse all T6SS(s) in this replicon]
Location [Strand]1983970..1987515 [-]
ProductIcmF-like protein
NoteTssM
UniProt IDM4U5E1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.80E-89, Aligned region: 510..825
ImcF-related_N [PF14331], Evalue: 9.60E-83, Aligned region: 199..461
DUF1215 [PF06744], Evalue: 6.50E-38, Aligned region: 918..1039
Protein Sequence: 1181 a.a.     [Download]
>gi|470479712|ref|YP_007640456.1| IcmF-like protein [Psychromonas sp. CNPT3]
MWNKLKTILMKVVPGLRAAMPILLVIIFILLNIAIWWAGPKLVISGDNPLQSVLARSITTIIFLLFCMTA
WGILQWRRLQRYHEEKDLEALHKNDPIKHYEERQEIELNQVMLAMKESMNKRNYLYALPWYLVLGLENAG
KTSLINRSGQNFVFSSVLRASGNKSENPYSFDWWISDDAVLIDPDGELLTQGNMDDSEEGEVERRLWLHF
IQWLEKIRSRRPLNGVVLALDIENLSTARTTERLAYSSLLRARLRELMEKLSTRLPVYITLTKLDLLYGF
EPFFRQYTRAQREQILGFTFTMDSVKDQDSWLGEFDENYSSFITRINDCLPRSLLSSIDAEERRAIYSFS
RQMAGMHDVLKQFLHEVLGSDQFSTSALVRGVYFLSVYQQGVPSNAFVDAASRRYSLPSSINSAQDAKNS
TPYFTQKLFSEVIYAEAGLASDNFRAAKHKRRLLMLSVVACSIASLLLIGSWHEYYKKNIAQANAVLVQV
NNYKKEYALDLLTTDSRDILVPLNTIRKATLEFGFFRDKSRFISDMGLYQGHIIGPKVEETYLNLLRNSY
LPILMQQVMKNLSIAQSDDNKLTLLRVYRMLTDKSGRNDKLVEDYFMHVWQKSYPRQRQTQEMLLLHLDY
AMQHTDLQGARQQGDKDALYVLQPYDSLVAKNQRALSVLPIAERVYRNLKKEAISVLGAPLDLRNNIGPV
FNLVFEQRMENHAHYLIPDFLTKDGFDRYFMPKSDLVSELALLDNWVLGKSKSAEFSEADKKVLRDKIRA
QYVADYTDTWRVAINNINVKYFADINGAVLVLDNITGNKQPFMRLLQTLKTNTRLFPTLPENAKERLELM
KLPKYKVATMIDSKFSQLNALLETQDTQPVYMDEVINAVDQLLSYLKSIQNAPDMGKAALAATQARVDLS
NADPIYVLQRIASGLPKPLDSMIKKLADESWYVVKQEAIKYLEVRWIDDVYKEYQEKLASRYPFDAQSKK
DVSLQDFEQFFAPNGTLNEFYNKQLKIFMDESLAKSESNSGHSLIRQEVLDQLQQAKKIQQAFFNRKGIL
NVEFSLEPIELSANKRRSVINVDGQYVEYSHGPRKSVELLWPNTLRASATSKVTLVPSAPNRSPRSIKIQ
GPWAFFRLLDKGQVISASATSVDYKFKIDGGYARYRLHSEADNNPFTTSLFKSFKLSNTLY
 
Nucleotide Sequence: 3546 bp     [Download]
>gi|470478036|ref|NC_020802.1|:c1987515-1983970 Psychromonas sp. CNPT3, complete genome
ATGTGGAATAAATTAAAAACAATATTAATGAAGGTAGTCCCAGGATTACGAGCAGCAATGCCTATTTTAC
TTGTTATAATTTTCATTTTACTCAATATTGCGATTTGGTGGGCGGGGCCGAAGCTAGTGATTTCAGGAGA
TAATCCTTTGCAGTCGGTGCTTGCGAGATCAATAACAACTATTATTTTTTTACTCTTTTGTATGACCGCT
TGGGGCATATTGCAATGGCGCCGTTTACAACGCTATCATGAAGAAAAAGATCTTGAGGCGTTGCATAAAA
ATGATCCTATTAAACATTATGAAGAGCGCCAAGAAATAGAGTTAAATCAAGTCATGCTAGCAATGAAAGA
AAGCATGAACAAGCGTAATTATTTATATGCATTGCCTTGGTACTTGGTTTTAGGATTAGAAAATGCAGGA
AAAACAAGTTTAATCAATCGTTCGGGGCAAAATTTTGTTTTTTCTTCTGTACTTCGAGCATCGGGTAATA
AAAGTGAGAATCCTTATTCATTTGATTGGTGGATAAGTGATGACGCTGTATTAATTGATCCCGATGGGGA
GTTACTAACTCAAGGTAACATGGATGATTCTGAAGAGGGTGAAGTTGAGCGACGTTTGTGGTTGCATTTT
ATACAGTGGTTAGAAAAAATACGCAGTCGTCGGCCTTTAAATGGGGTTGTTTTAGCGCTTGATATAGAGA
ACTTGTCGACAGCACGCACCACAGAGCGACTCGCTTATTCTAGTTTGTTACGTGCGCGTTTACGTGAATT
AATGGAGAAGTTATCAACGCGTCTTCCTGTTTATATTACGCTAACGAAGTTAGATTTGTTATATGGTTTT
GAACCTTTTTTCAGGCAATATACGCGCGCTCAACGTGAACAGATATTAGGTTTTACTTTTACGATGGATT
CGGTTAAAGATCAAGATAGTTGGTTAGGTGAATTTGATGAAAATTATTCATCATTTATAACCCGCATTAA
TGATTGTTTACCTCGTTCGTTATTAAGCTCTATTGATGCAGAAGAGCGTCGTGCTATTTATAGTTTTTCT
CGGCAGATGGCCGGAATGCACGATGTATTAAAGCAATTTTTACATGAAGTTTTAGGCAGTGATCAGTTTT
CAACTTCAGCGCTTGTGCGTGGGGTATATTTTTTATCGGTTTATCAACAAGGGGTTCCGAGTAATGCCTT
TGTTGATGCGGCTTCGCGTCGTTATAGTCTTCCATCTTCTATCAATAGTGCTCAAGACGCAAAAAATTCA
ACACCTTATTTTACGCAAAAACTCTTTAGTGAGGTCATTTATGCCGAGGCGGGTTTAGCATCAGATAACT
TTCGAGCAGCCAAACATAAACGTCGTTTACTTATGCTGTCAGTAGTTGCATGCAGTATTGCATCTTTGTT
ATTGATTGGCTCTTGGCATGAGTACTATAAAAAGAACATAGCGCAAGCGAATGCGGTATTAGTGCAGGTA
AATAATTACAAAAAAGAATATGCACTAGATCTATTGACAACGGATAGTCGCGATATTTTGGTGCCATTAA
ATACCATTCGTAAAGCAACATTAGAGTTTGGTTTTTTTCGTGATAAGTCGCGATTTATATCAGATATGGG
TTTATATCAAGGTCACATTATCGGGCCTAAAGTGGAAGAAACGTACCTTAACTTATTAAGAAACAGTTAC
TTGCCGATACTAATGCAACAAGTAATGAAGAATTTGTCAATCGCTCAAAGCGACGATAACAAGTTAACCT
TATTACGTGTATATCGTATGTTAACGGATAAAAGTGGGCGTAATGATAAATTAGTCGAAGATTATTTTAT
GCATGTGTGGCAAAAATCTTACCCTAGGCAGCGTCAAACCCAAGAGATGTTATTACTGCATTTAGATTAT
GCGATGCAACATACCGACTTACAAGGTGCCAGACAACAAGGAGATAAGGATGCTTTATATGTATTGCAAC
CATACGATAGTTTAGTGGCAAAAAATCAACGTGCATTGAGTGTATTACCAATAGCAGAGCGTGTTTATCG
TAATTTGAAAAAAGAAGCGATTAGCGTACTCGGTGCTCCATTAGATTTACGCAATAATATTGGCCCTGTG
TTTAATTTGGTTTTTGAACAACGTATGGAGAATCACGCGCATTACTTGATCCCTGATTTTTTAACTAAAG
ATGGTTTTGATCGTTATTTTATGCCCAAATCAGATTTGGTATCTGAATTGGCATTATTAGATAATTGGGT
ATTAGGAAAAAGTAAATCAGCAGAGTTTAGTGAGGCCGATAAAAAGGTCTTACGCGATAAAATTCGCGCT
CAGTATGTGGCGGATTATACTGATACTTGGCGAGTTGCTATCAACAATATTAATGTGAAGTATTTTGCTG
ATATTAATGGTGCGGTGTTGGTATTAGATAACATTACGGGCAATAAACAACCGTTTATGCGCTTATTACA
AACATTAAAGACGAATACACGTTTATTTCCAACATTACCAGAAAATGCCAAAGAAAGGCTTGAACTGATG
AAATTGCCAAAATATAAAGTGGCAACAATGATTGATAGCAAATTTTCACAATTGAACGCGTTATTAGAGA
CTCAAGATACTCAACCGGTATACATGGACGAGGTGATTAATGCGGTAGATCAATTATTATCTTATTTAAA
ATCTATCCAAAATGCCCCAGACATGGGTAAAGCTGCGTTAGCTGCGACACAAGCTCGAGTTGATTTGAGT
AATGCTGATCCTATTTATGTATTACAACGCATCGCATCAGGTTTACCTAAACCACTCGATTCTATGATTA
AAAAATTAGCAGATGAAAGTTGGTATGTTGTAAAACAAGAAGCGATAAAATATTTAGAGGTACGTTGGAT
AGATGATGTTTATAAAGAATATCAAGAAAAACTAGCGTCTCGTTATCCTTTTGATGCGCAATCTAAGAAA
GACGTATCATTGCAAGACTTTGAACAATTTTTTGCGCCTAATGGCACGTTAAATGAGTTTTATAATAAGC
AATTAAAAATATTTATGGATGAAAGTTTAGCGAAAAGTGAGAGTAATTCAGGGCATTCATTAATTAGACA
AGAGGTTTTAGATCAATTGCAACAAGCGAAAAAGATCCAACAAGCATTTTTCAATCGCAAAGGGATTTTG
AATGTAGAGTTTTCACTTGAGCCCATTGAGCTAAGTGCGAATAAACGTCGCAGTGTGATCAATGTCGATG
GGCAATATGTTGAATATAGTCATGGGCCACGAAAATCTGTTGAATTACTGTGGCCTAATACCTTACGAGC
ATCTGCGACAAGTAAAGTGACTTTAGTACCATCAGCTCCAAATAGATCACCACGAAGTATCAAAATACAA
GGGCCGTGGGCATTTTTCCGCTTATTAGATAAAGGGCAGGTAATAAGCGCAAGTGCAACGAGTGTTGACT
ATAAATTTAAAATTGATGGGGGTTATGCTCGTTATCGTTTACATAGTGAAGCGGATAATAATCCATTTAC
GACATCATTATTTAAATCATTTAAGTTATCTAATACACTGTATTAA
 Primer design