SecReT6
Protein ID: 471265740
SecReT6 ID742
T6SS typei3
Gene symbol-
Locus tagXCAW_00180
StrainXanthomonas citri subsp. citri Aw12879
Repliconchromosome [GenBank: NC_020815] [Browse all T6SS(s) in this replicon]
Location [Strand]227551..231075 [+]
ProductHypothetical Protein
NoteTssM
UniProt IDM4VVJ1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-90, Aligned region: 189..451
ImcF-related_N [PF14331], Evalue: 1.30E-90, Aligned region: 887..938
IcmF-related [PF06761], Evalue: 6.80E-69, Aligned region: 502..800
DUF1215 [PF06744], Evalue: 2.30E-28, Aligned region: 916..1038
AAA_22 [PF13401], Evalue: 2.40E-05, Aligned region: 127..264
AAA_22 [PF13401], Evalue: 2.40E-05, Aligned region: 433..481
AAA_16 [PF13191], Evalue: 0.0098, Aligned region: 118..242
AAA_16 [PF13191], Evalue: 0.0098, Aligned region: 572..587
AAA_16 [PF13191], Evalue: 0.0098, Aligned region: 778..892
AAA_16 [PF13191], Evalue: 0.0098, Aligned region: 876..944
Protein Sequence: 1174 a.a.     [Download]
>gi|471265740|ref|YP_007648205.1| Hypothetical Protein XCAW_00180 [Xanthomonas citri subsp. citri Aw12879]
MKTLLSKLSATVVVGLLALCLLSVLLWVGGPYVALAGWSPLSSVAARLLAIVLLLVVWVGVLALRRWRRQ
ARAATLSSALAAPGRDDDRELRSGQERAQLQARFQQAIQLLRKRRGGADLYTLPWYALIGPPGSGKSTLL
QHSGLQFPLAARMGDAALRGVGGTRDCEWWFTDEAVFLDTAGRYTTQDSDQAVDAGAWRDFLRLLRRYRP
RRPLNGVLVTMSMSDLLLLDDAERDTHMQAIRRRLDELAEQLQASVPVYLIFTKCDLIGGFGEFFDDLTP
AQRNQVWGMTFALAQTLDGHAARKFADEFGVLQQQLSARLFERLNLERDRLRRAAILSFPQQVAALGERA
RQFVEGTFAGNAYGPAPLLRGVYFTSGTQDGTPIDRMMGAVARTFGLEEARVQAPGAQRRTFFVERLLRE
VVLRESGLANAPPAQQRRRAWLQAAAYAGVALLTGAALAGLGLSYLGNRAYLQQVRAALEARPAVPDPHA
ATGMPEYVARTLQQADATQAVVKVAQQYHAGAPWSLRMGLFQGQALGEQVRAGYLRQLNATLLPALAVRL
RTGLVDNAQAPQALYYTLKGYLMLGQPQHLDPAQLSALAAIEAEKLFPGEPALQQALSAHLQAVLESPTH
VRALSLDNQRIAQARASLRAADLSTLIYGNLLLTPPDGTPLRLDKALGLLADTFVRRSGTALSMPVPALY
TQPVFAALQREGIGQAVERFGRDDWVFGGAALDASARATLVREVGQRYTADYIRYWDGLLADLQLRPSAD
LAGASATAAKLAGPSSPLRLLLGVVGEHTQAMDRAPPADPAQRALAAAASSAGAKANAAAAKLPGGAAIS
AALATPADGAAAAAPAPGAAISEHFLALNALAAGAPGSTPLDHLLSVLDQLGKQLLVISQGGGDAAAANA
QLALARQEMAQLPPPVTDWLQSLAGSSATLMTQGARAALDAQVRQSVGEVCTDFVRGRYPFDPEAQVEIP
LQNFGELFGSGGRLETLYTGTVKPLLDTQSPQWRWKDGPDAVIGAPGLPVQLQLAQRIRQKYFRGGPTPQ
IGFTVLAPTLGEGVTRLTLDIEGQRYDYQPGAAQSMPMIWPGPVPGHVSIAAFGADGVALGTLDYQGDWA
LFRALQAGHLENPSDLRFVASFALGGHDVQVPLRAGNLRHPFLDRDVQHFACGG
 
Nucleotide Sequence: 3525 bp     [Download]
>gi|471265562|ref|NC_020815.1|:227551-231075 Xanthomonas citri subsp. citri Aw12879, complete genome
ATGAAGACGCTGTTGTCCAAGCTGAGCGCAACGGTGGTGGTCGGCCTGTTGGCGCTGTGCCTGCTGTCGG
TGTTGCTGTGGGTGGGTGGGCCGTATGTGGCGCTGGCCGGCTGGAGCCCGCTGAGCAGCGTGGCGGCGCG
GTTGCTGGCGATCGTGTTGCTGCTGGTGGTGTGGGTGGGTGTGCTGGCGCTGCGCCGCTGGCGCAGGCAG
GCGCGTGCGGCGACCTTGTCCAGCGCCCTGGCGGCGCCCGGCCGCGACGACGACCGCGAGCTGCGCAGCG
GACAGGAACGCGCGCAGCTGCAGGCGCGCTTTCAGCAGGCGATCCAGCTGCTACGCAAGCGGCGCGGCGG
CGCCGATCTGTATACGCTGCCGTGGTATGCGCTGATCGGCCCGCCCGGTTCGGGCAAGAGCACCTTGCTG
CAGCATTCGGGCCTGCAGTTTCCGCTGGCTGCGCGCATGGGCGATGCGGCGTTGCGCGGCGTCGGCGGCA
CCCGCGATTGCGAATGGTGGTTCACCGACGAAGCGGTGTTCCTGGACACCGCCGGGCGCTACACCACGCA
GGATTCGGATCAGGCGGTGGATGCCGGGGCGTGGCGCGATTTCCTGCGCCTGCTGCGACGCTATCGCCCA
CGCCGCCCGCTCAACGGCGTGTTGGTGACGATGAGCATGTCGGACCTGTTGCTGCTCGACGATGCCGAGC
GCGACACGCATATGCAGGCGATCCGCCGCCGCCTGGACGAGCTGGCCGAGCAGTTGCAGGCCAGCGTGCC
GGTGTATCTGATCTTCACCAAGTGCGATCTGATCGGCGGCTTCGGCGAGTTCTTCGACGATCTGACGCCG
GCGCAGCGCAACCAGGTGTGGGGCATGACATTTGCGCTGGCGCAGACCCTGGACGGGCACGCGGCGCGCA
AGTTCGCCGACGAGTTCGGCGTGCTGCAGCAGCAGCTGAGCGCGCGCCTGTTCGAACGCCTGAACCTGGA
GCGCGACCGTCTGCGGCGTGCGGCGATCCTGTCGTTTCCGCAACAGGTTGCCGCTCTTGGCGAGCGTGCA
CGGCAATTTGTCGAAGGCACGTTCGCCGGCAATGCGTATGGCCCGGCACCGCTGCTGCGCGGGGTGTACT
TCACCTCCGGCACCCAGGACGGCACGCCGATCGACCGCATGATGGGCGCGGTGGCGCGCACCTTCGGCCT
GGAAGAAGCGCGCGTGCAGGCACCGGGCGCGCAACGCCGCACCTTCTTCGTCGAGCGGCTGCTGCGCGAG
GTGGTGCTGCGCGAATCCGGCCTGGCCAATGCTCCGCCCGCCCAGCAGCGCCGCAGGGCGTGGTTGCAGG
CCGCCGCGTACGCGGGTGTGGCGTTGCTGACCGGCGCCGCGCTGGCCGGGTTGGGGCTCAGCTACCTGGG
CAACCGTGCGTACCTGCAGCAGGTACGTGCTGCACTGGAGGCGCGGCCGGCAGTGCCCGATCCCCATGCC
GCCACCGGCATGCCCGAGTACGTCGCGCGCACCCTGCAGCAAGCCGATGCGACGCAGGCGGTGGTGAAGG
TGGCGCAGCAGTATCACGCCGGCGCGCCGTGGTCGTTGCGCATGGGATTGTTCCAGGGACAGGCGTTGGG
CGAGCAAGTGCGGGCGGGCTATCTGCGTCAGCTCAACGCCACCTTGTTGCCGGCCTTGGCGGTGCGCCTG
CGCACCGGTCTGGTGGATAACGCGCAGGCGCCGCAGGCGCTGTACTACACGCTCAAGGGCTATCTGATGC
TGGGCCAGCCGCAGCATCTGGACCCGGCGCAACTCAGCGCGCTGGCGGCGATCGAAGCCGAAAAATTATT
CCCGGGCGAGCCGGCCTTGCAGCAGGCGCTGAGTGCGCATCTGCAGGCGGTGCTGGAGTCGCCCACGCAC
GTGCGTGCGCTGTCGCTGGACAACCAACGCATCGCCCAGGCACGTGCCAGCCTGCGTGCCGCCGATCTGT
CGACACTGATCTACGGCAACCTGTTGCTGACCCCGCCGGACGGCACGCCGTTGCGGCTGGACAAAGCGCT
GGGCCTGCTGGCCGACACCTTCGTGCGCCGCAGTGGCACGGCGTTGTCCATGCCGGTGCCGGCGCTGTAC
ACACAGCCGGTGTTCGCCGCCCTGCAACGCGAGGGCATCGGCCAGGCGGTGGAACGCTTCGGCCGCGACG
ATTGGGTCTTCGGCGGTGCGGCGCTGGATGCGTCTGCCAGGGCCACGCTGGTGCGCGAAGTGGGGCAGCG
CTACACGGCCGACTACATCCGTTACTGGGATGGACTGCTGGCCGATCTGCAACTGCGCCCCTCGGCCGAT
CTGGCCGGTGCCAGCGCCACTGCCGCCAAGCTGGCCGGGCCCAGTTCGCCCCTGCGGCTGCTGCTGGGCG
TGGTGGGCGAGCACACCCAGGCGATGGACCGCGCACCGCCGGCAGACCCCGCGCAACGCGCGCTGGCGGC
TGCCGCCAGCTCGGCAGGCGCCAAGGCGAATGCGGCCGCGGCCAAACTCCCCGGCGGGGCGGCGATCAGC
GCCGCGCTGGCCACGCCCGCCGATGGTGCCGCAGCTGCGGCGCCGGCACCGGGTGCGGCGATCAGCGAGC
ATTTTCTGGCGCTCAACGCCTTGGCCGCCGGCGCGCCCGGCAGCACGCCGCTGGACCATCTGCTGAGCGT
GCTCGATCAGCTCGGCAAGCAATTGCTGGTGATCTCCCAGGGCGGCGGCGATGCCGCGGCGGCCAACGCG
CAACTGGCATTGGCCCGGCAGGAAATGGCGCAACTGCCACCGCCGGTGACCGACTGGCTGCAGAGCCTGG
CCGGCAGCAGCGCCACCTTGATGACCCAGGGTGCACGCGCCGCACTGGATGCGCAGGTCAGGCAATCGGT
GGGCGAGGTGTGCACGGATTTCGTGCGTGGCCGCTACCCGTTCGATCCGGAGGCGCAGGTGGAGATTCCG
CTGCAGAATTTCGGCGAGTTGTTCGGCAGTGGTGGGCGTCTGGAGACGCTCTACACCGGCACCGTCAAAC
CGCTGCTGGACACCCAGTCCCCGCAATGGCGCTGGAAGGATGGCCCGGACGCGGTCATCGGCGCACCCGG
TCTGCCGGTGCAACTGCAGTTGGCGCAACGGATCCGGCAGAAATATTTTCGCGGCGGGCCCACGCCGCAG
ATCGGCTTTACCGTGCTGGCGCCCACGCTGGGCGAGGGCGTGACCCGGCTGACGCTGGATATCGAAGGCC
AGCGTTACGACTACCAGCCCGGCGCGGCGCAAAGCATGCCGATGATCTGGCCCGGCCCGGTGCCGGGGCA
TGTTTCCATCGCCGCGTTCGGCGCCGATGGCGTGGCGCTGGGAACGCTCGACTACCAGGGCGACTGGGCG
CTGTTCCGTGCGCTGCAGGCCGGGCACCTGGAAAACCCATCGGATCTGCGCTTTGTCGCCAGCTTCGCGC
TTGGCGGCCACGACGTGCAGGTGCCGCTGCGTGCCGGCAACCTGCGCCACCCGTTTCTGGACCGCGACGT
CCAGCACTTCGCGTGCGGCGGATGA
 Primer design