SecReT6
Protein ID: 472323939
SecReT6 ID743
T6SS typei1
Gene symbol-
Locus tagH681_03815
StrainPseudomonas denitrificans ATCC 13867
Repliconchromosome [GenBank: NC_020829] [Browse all T6SS(s) in this replicon]
Location [Strand]823093..824100 [-]
Productserine-threonine kinase Stk1
NoteStk1
UniProt IDM4XBB8
KEGG IDpdr:H681_03815
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 6.50E-36, Aligned region: 54..317
Pkinase_Tyr [PF07714], Evalue: 1.20E-20, Aligned region: 55..317
Protein Sequence: 335 a.a.     [Download]
>gi|472323939|ref|YP_007656185.1| serine-threonine kinase Stk1 [Pseudomonas denitrificans ATCC 13867]
MTAESLAPTLSGQPTGADNCTYFAFVGEPTAPPAPAKSEMAEMPPLPEILAGRFQLERLLGVGGMGAVYR
ARDLLREQFGDPDPYVAVKLLNEEFAEYPDASTLLYSEFALTMRLRHPHIVRLHSFEVDSICRRAFITLE
LMRGLTLDQLLCERPKGLPWDECRGIALSLLDALAYSHDCGVLHGDLKPSNVMLAEDGARLFDYGLGQPR
EGLLDGLPRLARERFNAWTPRYAALELLDGAPISPASDLFAAACVLHELLTGEHPYRRLDAREASAQQLD
RQLKSPSPLESRTWQALRTALALNENERRISVRELREAFIAQPKAKRRWFQRRNG
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|472323176|ref|NC_020829.1|:c824100-823093 Pseudomonas denitrificans ATCC 13867, complete genome
ATGACAGCCGAAAGCCTCGCACCCACGCTCAGCGGCCAGCCCACCGGAGCCGACAACTGCACCTACTTCG
CCTTCGTCGGAGAGCCCACCGCGCCACCGGCGCCAGCGAAGAGCGAAATGGCCGAGATGCCGCCGTTGCC
CGAGATCCTTGCCGGCCGCTTCCAGCTGGAGCGCCTGCTCGGCGTGGGCGGTATGGGCGCCGTCTACCGC
GCGCGCGACCTGCTGCGCGAGCAGTTCGGTGATCCGGACCCATACGTCGCGGTGAAGCTGCTCAATGAGG
AGTTCGCCGAATACCCCGACGCCAGCACCCTGCTCTACAGCGAGTTCGCCCTCACCATGCGCCTGCGCCA
CCCGCATATCGTGCGGCTGCACAGCTTCGAGGTGGACAGCATCTGTCGCCGGGCCTTCATCACCCTGGAG
CTGATGCGCGGCCTGACCCTCGACCAGTTGCTCTGCGAACGCCCCAAAGGCCTGCCCTGGGACGAATGCC
GCGGCATCGCCCTCAGCCTGCTCGACGCCCTGGCCTACTCCCACGACTGCGGCGTGCTGCACGGCGACCT
GAAGCCCAGCAATGTGATGCTCGCCGAAGATGGCGCACGGCTCTTCGATTACGGTCTCGGCCAGCCACGG
GAGGGCCTTCTGGATGGCCTTCCACGGCTCGCGCGCGAGCGCTTCAACGCCTGGACGCCACGCTATGCGG
CCCTGGAGCTCCTCGATGGCGCACCGATCTCGCCCGCCAGCGATCTCTTCGCCGCCGCCTGCGTCCTGCA
CGAGTTGCTGACCGGTGAACACCCCTACCGCCGACTCGACGCCCGCGAGGCCAGTGCCCAGCAACTGGAC
CGTCAACTCAAATCGCCATCCCCGCTGGAGTCCCGCACCTGGCAGGCCCTGCGCACCGCGCTGGCGCTGA
ATGAAAACGAGCGACGCATCAGCGTCCGCGAACTGCGCGAGGCTTTCATCGCGCAACCCAAGGCAAAGCG
CCGCTGGTTCCAACGGCGCAACGGATGA
 Primer design